CAZyme Information: MGYG000000690_01292

Basic Information

• Species: CAG-590 sp000431135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-590; CAG-590 sp000431135
• CAZyme ID: MGYG000000690_01292
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000000690_24|CGC1	41212.41	7.0756

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000690	2764780	MAG	Kazakhstan	Asia

• Gene Location: Start: 33750; End: 34823 Strand: +

Full Sequence      

MSIERKRILYFVEAMGGGVFTYIVDLANELVNEYDMYIAYAIRPQTPADYKEYFDKRIHL
IEVKNFGREIDPIKELRAISEVKQIAREVQPDIIHLHSSKAGAIGRIAFNGKNIPLFYTP
HGYSFLMQNYKPIKRWMFKKIEKFLATRKCTTISCSVGEHQETLKLTNNATYVNNAINIA
DLQRALDGIEEKKHPLTVFTLGRICEQKNPELFNQIAQRMPNVQFLWIGDGEQREKLTSP
NIEITGWVKREKALQMSVNADVFVLTSSWEGLPISLLEAMYMKKLCVVSDVIGNRDVIHN
GDNGCVCKSVDDFVRAISERNNQYIEKAYQDLLENYETKIQAERYEQIYMISIGEQT

Enzyme Prediction     

No EC number prediction in MGYG000000690_01292.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	192	317	2.4e-22	0.86875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03808	GT4_CapM-like	6.16e-64	7	346	1	358	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03801	GT4_PimA-like	3.78e-49	8	349	5	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	9.39e-36	16	356	14	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03811	GT4_GT28_WabH-like	1.52e-32	7	348	1	350	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03819	GT4_WavL-like	2.88e-29	8	301	1	297	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVK50114.1	9.22e-183	1	349	1	353
CBL26457.1	3.25e-180	4	349	3	350
BBH27396.1	6.38e-175	4	349	3	350
ARE22188.1	7.63e-175	4	355	3	356
AEV69377.1	2.11e-165	4	353	3	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XYW_A	1.05e-08	81	312	69	296	GlycosyltransferasesWbnH [Escherichia coli]
6N1X_A	1.19e-07	59	355	57	377	ChainA, Glycosyltransferase [Staphylococcus aureus subsp. aureus CN1]
6D9T_A	1.26e-07	59	355	73	393	BshAfrom Staphylococcus aureus complexed with UDP [Staphylococcus aureus]
5N7Z_A	2.68e-07	73	314	69	315	glycosyltransferasein LPS biosynthesis [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],6Y6G_A Chain A, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5N80_A	2.69e-07	73	314	70	316	glycosyltransferaseLPS biosynthesis in complex with UDP [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48453	1.30e-15	7	304	2	304	Uncharacterized 41.2 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
Q58459	2.24e-08	56	298	47	316	Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1059 PE=3 SV=1
P71053	3.73e-08	71	319	60	333	Putative glycosyltransferase EpsD OS=Bacillus subtilis (strain 168) OX=224308 GN=epsD PE=2 SV=1
O32272	3.82e-08	87	293	105	318	Putative teichuronic acid biosynthesis glycosyltransferase TuaC OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaC PE=2 SV=1
Q8S4F6	8.40e-08	77	345	180	477	Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana OX=3702 GN=SQD2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000690_01292.