CAZyme Information: MGYG000000692_00045

Basic Information

• Species: Prevotellamassilia sp900543155
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900543155
• CAZyme ID: MGYG000000692_00045
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1142		125446.18	5.109

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000692	2730358	MAG	Kazakhstan	Asia

• Gene Location: Start: 49453; End: 52881 Strand: +

Full Sequence      

MKIKHYIALAALTMPLAASAQSHEIDFETNAGYTSVDVFDTWENSPFRKGELTGNVKVVS
NPNKENDELAGEVNPSAKALAFQRSRFGSNTFGVRVNLETPIALSQSAQYVHVMMLKPKE
GRVMCFALGSREDRPWQSKEVVQVEAASITKVGSDNRWYDAVFALTGAEGVNVHSLVFAP
EVESQHDATEDYVVYIDNVVVNNSSMARIAYDAYPTNFLKTEKLSRSDRYAKGISMKSSD
GAQSIAVNQQSDKLMFQDYLSSQMKAKAGETVTVNTDYNGTWMNAYVYLDQNKDGKFDCT
LNENGTPTEGSDVMSYSHYNKKNSKGETIANGNSRTLPDFTIPKDLKPGFYRLRYKIDWD
YIDAAGNPGNADGGNTIKGNGGAVIDTRLNIHTDKVTLTRGLSNAGTNGEVTLADSVTAL
NGQEIPFGQPVTVKFRPAAGFKLGAFTIRHGYNLKGDSLIHETPQYMDVVIPAYMAKNNT
YTIPAELVDGDVCITPTFLTTESGGEATEKYALNFEKDLEINRPNNDRAFNSLSFNTTTN
STAQKLSSANKKLVYQDFSSKNIYVKDGDVITTNISYLGNGSQCMHAYLYVDLDGDGVFN
TNVNANGTPAFDGEMLSYTYANGKNSKGANAGVNDKATCCWGATNSIPQFSLPAGLPKGT
YRARVKIDWDNTDPAGTYGPNYSGNFINNNGGYVIDFNFDVVNEYPKVKLDVQTTDGSIV
GAGNTGLPEYIMEGQDIDVKAVGLDENYTTTGITVRHGKNLNGEQTVNGEKQWEEYTAEV
TDGSCTIPGDKVNGDVRLTAVFKNNGSSPYKLVFADEFNTEDGSQPDSHFWTRSSRENPT
WKRFCAQTVAGQKKTGWIEDGKLVLKCVKNTFDDELDGNKNKQQMISGAIESSDKVTFTY
GKVEGRVKNIGHSGNFPAFWMMPNKATYGGWPYSGEIDIWEQIDAANTTYHTIHTKWANS
TKDGSECMNKGNDPQKSGTSTAALDEYHTYGLEWTEDILKWFVDGKQVFSYARKTDLTGD
NATAQWPYNKPFYIILNQSVGNGGWAAAPDVNFEYETKFDWVRVYQKEGGDIATGINHAQ
ANSDVDIYAYPGKVRIVSAKAAHVSIVDMQGRTVFAQTVQGNENVYLPSGVYVANGKKVL
VP

Enzyme Prediction     

No EC number prediction in MGYG000000692_00045.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	815	1065	6.6e-53	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	5.78e-60	814	1065	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	5.48e-26	816	1065	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02182	GH16_Strep_laminarinase_like	1.45e-24	810	1066	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
COG2273	BglS	8.53e-23	802	1065	41	263	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd08024	GH16_CCF	2.52e-22	812	1041	1	275	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12302.1	2.58e-155	1	827	5	804
QFQ13169.1	1.22e-88	509	1067	23	542
QUB87116.1	4.52e-66	795	1138	33	331
AKU69476.1	4.52e-66	795	1138	33	331
QUB68183.1	2.67e-64	808	1138	46	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XOF_A	6.32e-31	808	1067	22	268	ChainA, GH16 family protein [uncultured bacterium]
6T2R_AAA	1.90e-30	810	1066	29	262	ChainAAA, Beta-glycosidase [Bacteroides caccae]
6XQF_A	2.91e-30	808	1067	22	268	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]
4CRQ_A	6.34e-27	810	1067	3	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6JH5_A	9.39e-26	810	1067	4	233	Structureof Marine bacterial laminarinase [Aquimarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	4.90e-34	807	1076	53	301	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	1.36e-24	785	1066	2	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	2.78e-23	753	1068	368	682	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q27082	7.08e-18	810	1066	25	253	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
C1IE32	2.25e-17	859	1049	65	245	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000323	0.998872	0.000225	0.000190	0.000189	0.000173

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000692_00045.