CAZyme Information: MGYG000000692_00440

Basic Information

• Species: Prevotellamassilia sp900543155
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900543155
• CAZyme ID: MGYG000000692_00440
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000000692_10|CGC2	42452.15	8.773

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000692	2730358	MAG	Kazakhstan	Asia

• Gene Location: Start: 15409; End: 16551 Strand: -

Full Sequence      

MKIFLIAGEASGDLHAAHLMRAIKQQHPDVEFRFYGGDEMQAVGGTLLCHYRDLAYMGFV
QVALHLRTILRGMAQCKRQIAEWNPDALILVDYPGFNLKMARFVKDHAICPVYYYISPKI
WAWKEHRIHAIRRDVDRLFSILPFEIDFFEGKHHYPISYVGNPSVDEVSAYVAAHGAPKS
DGQTIALLPGSRRQEIADNLSRMLQAALPFSANHKLVIAKAPAIESDFYSRIISASGIDA
SRVQMVSGETYALLSHATAALVTSGTATLETALFRVPQVVCYYMRCGWFISRVRPYFLKV
PFISLVNLIAGREVVPELVADGMNVENVRAHLSQLLPADSPARLAQLQGYEEMANRLGEP
GAPERAASEIVRLIKTRKKS

Enzyme Prediction     

No EC number prediction in MGYG000000692_00440.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	357	4.7e-110	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.65e-111	1	379	2	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.01e-104	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.98e-73	3	370	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.67e-69	3	373	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.36e-47	1	327	2	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77942.1	6.93e-154	1	375	1	377
QRO23865.1	1.64e-147	1	378	1	378
QDH54418.1	4.69e-147	1	375	1	377
ALJ61154.1	1.64e-146	1	374	1	376
QNL40994.1	2.69e-146	1	375	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	9.28e-42	1	373	7	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.80e-41	1	373	7	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.87e-69	2	374	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	5.94e-65	3	375	6	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B8JE78	1.66e-64	2	375	10	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	2.34e-64	2	375	10	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q2IL69	1.41e-62	2	375	10	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000692_00440.