CAZyme Information: MGYG000000692_01536

Basic Information

• Species: Prevotellamassilia sp900543155
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900543155
• CAZyme ID: MGYG000000692_01536
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304		35312.4	10.1794

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000692	2730358	MAG	Kazakhstan	Asia

• Gene Location: Start: 5066; End: 5980 Strand: -

Full Sequence      

MNIRRHLVFLMALFCVWSMHAQTAYQQYIERYAPMAQDQMKRYGIPASITLAQGLLESGA
GKSRLAREANNHFGIKVGMNWTGPYMIMADDRPDDKFRVYNTVSESYEDHSVFLRNGRRY
AFLFDLSASDYKGWAHGLKRAGYATSPTYAQSLISMIERFNLHEYDKKKHHRREDKIEHK
AQIEYKTFADGRPIRRCNGQFYVIAREGDTYASVARAVKQKEDKLRKYNDVDAKRQLSAG
DVVYLGKKRKKADPGMKRRYHVMEAGESLYSISQRFGIRLSSLCKMNPISNNYHFKVGDE
IKIK

Enzyme Prediction     

No EC number prediction in MGYG000000692_01536.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	33	162	8.1e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.32e-41	26	169	44	191	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	3.78e-39	26	166	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	1.59e-28	24	166	7	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	2.37e-28	33	162	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12709	flgJ	9.60e-24	28	159	176	318	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ11765.1	1.74e-91	12	304	12	323
QDO71591.1	1.76e-84	1	304	1	305
QJR97929.1	6.45e-84	6	303	6	301
ADE83099.1	1.08e-82	24	304	25	303
QVJ81211.1	1.08e-82	24	304	25	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	5.45e-15	44	158	22	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	5.57e-15	26	157	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	6.75e-15	26	157	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5DN4_A	7.49e-15	44	158	22	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3K3T_A	4.62e-14	26	157	3	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.01e-19	26	166	49	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P15931	2.99e-13	44	158	171	295	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
Q9KQ15	1.28e-11	28	163	164	312	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9X9J3	1.98e-11	26	159	161	304	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P37710	1.42e-10	27	304	182	473	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001902	0.967051	0.030273	0.000266	0.000247	0.000249

TMHMM  Annotations     

start	end
7	29