CAZyme Information: MGYG000000692_01964

Basic Information

• Species: Prevotellamassilia sp900543155
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900543155
• CAZyme ID: MGYG000000692_01964
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1280	MGYG000000692_122|CGC1	140915.8	5.6464

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000692	2730358	MAG	Kazakhstan	Asia

• Gene Location: Start: 2337; End: 6179 Strand: +

Full Sequence      

MKHRILCFLMLLSLLPCATWAQTFVNLTPRPKTMTVGTGSLNMPTQFTVNYTDLDEDGVN
EVKQFVAAYTAVTGAEVNITTGDENALFQVAILPPANTLKESGYTLNITTNKVEVKGKSA
LGLFYAFQSVKKMLPANVMAGVKDAKITTYALPVVNITDQPRFDYRGFMLDVSRHFFTVN
EVKRMIDVMAAYKMNAFHWHLSDDQGWRVEIKKYPKLTTVGSIAPNSRFTDMEECTQYWI
NKPYGPYFYTQEEIKDVVAYAKARHIEVIPEIDMPGHFCAAMTAYPEYSCSPNGNHRIWD
DGGISSDVMNVANPEAVQFAKDILGELIELFPSQYIHIGGDECPTNAWQGNDECKALYKK
LGLTHYRQLQSQFIKQMDEFVKSKGRKLAVWNESISAEGADLNIVKATDATVFCWTNPEA
AVDQAKKLGLKSIYTPWGPYYINRRQGNTEKDPPGAGYGTDHVQATYNQNIPANTTYGVQ
GTFWTEHVSDAEYMEWLALPRLIAIAERGWTPEANKNFSDFQKRMSADTVMLNYGNYKYC
KYYMLGTETGGSNNDKVMPFANTADKKYYYRIISGGTDATRVGRCIELLAEGSELITANS
GKGAKAGVLWTSPQAAEGATNYDYQWWSIEEDPANPGKYALVCKAQPNGSVNAAPTATNT
GGRWTYDNNAKHYNFTLGAGAYGKKGNNYYYSLSSDKVNGQYLNSSMAGQGLAVNVYSNP
NDGAGGQWEFSPLENYGSTETPVTFDYLVEGKAYTFSNAVEGFEGLALADDNQGNNLKVS
ADLYANNAWIAESVTTNADGSQTLKLKNAVTGRYITDLGNFQNRVGSAANVGASQAEANV
TLSLNAKYNDLRVKVAGKSLFPLPTGQVNAGSTISNGADAARNQGSEWTVQQVNVVTFTC
VDDLGSTLGTYTRSIPASVNEITAEFCPTIKNNSVQNIEATGENAYKVTYKRSAYSVVYN
CTTERGAIISSDEIAVPVGEKHKVAVPEHKYFSFKSADATNGEELTLTADRTINAVYTTE
ATIGVKKDGNVVTKLEANKDYLMYDATTASGRAGYRCVNSSDKNINRVLSAEGQNASIIW
NLQGSGNRFKVYNVGEELYVPQLVLSQAVKATRNGDTFTFSLNEDGATWKIQGSNNMRWD
GIENGSLVGWNQGNGHPIRITTFYAQPMFQITQACSKLDKGDDTFDLTQVLVNAGSAYTF
VYPQIEGYTLDHVTGLENFEGTVESNLNVVAYYSPVDAINNVTVDNKAKNKGIYDLQGRR
LLRIQQPGLYIINGQKVLVK

Enzyme Prediction     

No EC number prediction in MGYG000000692_01964.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	158	512	3.8e-111	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	2.10e-162	163	525	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	1.37e-129	163	512	1	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	2.90e-101	91	539	191	642	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	3.24e-89	163	525	1	329	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
cd06570	GH20_chitobiase-like_1	6.54e-79	163	525	1	311	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12561.1	7.57e-261	4	950	6	1011
QUB42028.1	9.07e-181	8	545	7	548
AAW30398.1	4.28e-158	99	577	218	715
QUT70076.1	2.94e-140	25	544	24	545
QUT42279.1	3.07e-139	25	544	24	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DUP_A	7.97e-140	25	544	4	525	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
7DVB_A	4.26e-139	25	544	4	525	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
6Q63_A	5.31e-93	64	542	68	539	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
6EZR_A	1.67e-74	98	541	205	639	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
6EZT_A	1.83e-73	98	541	202	636	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	4.40e-89	7	554	9	545	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	2.98e-72	98	539	93	529	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P96155	1.71e-62	98	509	204	604	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
B2UP57	3.11e-56	98	526	54	463	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
Q04786	5.11e-55	26	510	199	717	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000753	0.620864	0.377735	0.000249	0.000199	0.000177

TMHMM  Annotations     

start	end
5	24