CAZyme Information: MGYG000000695_00047

Basic Information

• Species: Prevotella sp000436035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436035
• CAZyme ID: MGYG000000695_00047
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545	MGYG000000695_1|CGC2	61193.49	9.6313

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000695	3484843	MAG	Kazakhstan	Asia

• Gene Location: Start: 67196; End: 68833 Strand: +

Full Sequence      

MKRILFGIALMAAATTTFAQSNDKTKQVAGPMEDVNHVIDNTVDSLNKAMTARITPGTSR
KGNNPVLFLIGNSTMRNGTLGNGNNGQWGWGYYEHEFFDENKITVENQALGGMSSRTFYN
RLWPDVRKGIKKGDWVIISIGHNDNGPYDSGRARASIPGIGKDSLNVTIKETGVRETVYT
YGEYMRKYINDCKALGAHPILMSLTPRDAYDENDKIVRVNKTFGLWAKQVAEQEGVPFVD
LNEISAAKLDSYGHWKEKYHFFTDHIHTSRFGAMMNARSAAEGIAESKDPNLAPLQAMMI
NVALPVENFKREPGKPVVFLTGDSTVKNADKDKDGMWGWGSQAYTVFDQKKITCVNAAKA
GRSSRSYLNEGRWEKVYNSLQPGDYVLIEFGHNDICSLTDKKMRGSIPCAKDTCHVYQME
ENKQYEVVYSFGWYLKKFIQDVREKGATPILVSLTPRNEWPKGKIERRNDTYGKWYREVV
AETGVAFLDLHNISGDALDKIGQKKAKAYYNHDHTHTSLKGAQLNAKSVAKGLKKMKSPL
AKYLK

Enzyme Prediction     

No EC number prediction in MGYG000000695_00047.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	318	533	2.2e-62	0.9904761904761905
CE12	67	284	6.3e-52	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	1.16e-72	316	533	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
cd01821	Rhamnogalacturan_acetylesterase_like	5.37e-65	65	284	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
COG2755	TesA	1.55e-19	316	536	9	211	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
cd00229	SGNH_hydrolase	3.14e-11	317	531	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
cd00229	SGNH_hydrolase	5.05e-11	67	273	1	177	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85051.1	9.02e-290	2	545	14	553
ADE81450.1	1.42e-273	27	545	10	527
QVJ82319.1	3.55e-272	27	545	10	548
AGB28256.1	1.02e-263	8	533	2	524
QRQ55820.1	2.08e-248	1	545	1	544

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DEO_A	9.06e-27	318	533	3	212	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]
3C1U_A	4.34e-26	318	533	3	212	ChainA, Rhamnogalacturonan acetylesterase [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5BAA2	4.79e-26	318	533	20	224	Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN2528 PE=1 SV=1
Q00017	7.34e-26	318	533	20	229	Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus OX=5053 GN=rha1 PE=1 SV=1
O31528	1.86e-21	318	540	5	209	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
O31523	3.53e-21	315	544	4	223	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
P42304	1.56e-09	303	535	164	376	Uncharacterized esterase YxiM OS=Bacillus subtilis (strain 168) OX=224308 GN=yxiM PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.010211	0.986640	0.000743	0.000833	0.000626	0.000919

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000695_00047.