CAZyme Information: MGYG000000695_00895

Basic Information

• Species: Prevotella sp000436035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436035
• CAZyme ID: MGYG000000695_00895
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693	MGYG000000695_8|CGC1	76914.73	8.7977

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000695	3484843	MAG	Kazakhstan	Asia

• Gene Location: Start: 62298; End: 64379 Strand: -

Full Sequence      

MKRLISAVILSAAVVLPTMAQKNSKTLSNGYPFAQVPFTSVKISQNTFWGARLQAAQKVT
IPLAFSKCESEHRYKNFEMAAYTLQHPNHEGLTTPAWDVSKFMGFSFDDTDVYKTIEGAS
YILQTYPDKKLKAYIDSVLNVVGAAQEPDGYLYTARTINPKHPHGWSGDKRWEKEEVLSH
ELYNLGHMVDAACAHYQATGSTKFLNIAKRYADCVVKEVGPKQGQATVVPGHQIAEMALA
RLYTLTGEKKYLDEAKYLLDYRGKTHIKDIYSQSDKPILEQSEAWGHAVRAGYMYAGIAD
VAALTQDSDYIKTIDRIWNNIVSKKYYLTGGVGARHAGEAFGANYELPNMTAYNETCAAI
SMVYLFERMFLLHGESKYIDCLERTLYNGVISGMSMDGGRFFYPNPLSSDGKYKFNSDGN
TTRQPWFGCACCPSNLCRFIPSVPGYLFGVKDNNIYVNLFAGNTSTIKVGGKNVVLEETT
EYPWDGDIKITVKKSAAKNANLLVRIPGWVRNQVVPSDLYAYRDAEKPTYSVTVNGKAVE
ADLVANKGYLPVKNIKKGDVVRIHFDMPVRTVVANGKVADDRGKVAVERGPLVYCAEAAD
NAGEPVLRAVMGSKKPAFTLVDNYTIQNTETKGAPAFAVKAIQTPAQVLDQAADGKVSVK
NMNLTLIPYYAWNHRGANQMNVWFYQNLAVLDK

Enzyme Prediction     

No EC number prediction in MGYG000000695_00895.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	45	595	6.9e-199	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	48	595	8	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.94e-150	33	683	9	584	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	5.80e-04	186	317	414	563	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67047.1	0.0	1	693	1	691
BCS84603.1	0.0	20	688	3	658
VEH14288.1	0.0	2	683	3	666
AVM58298.1	1.20e-306	10	683	9	654
AVM52620.1	6.04e-304	1	683	1	654

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	7.95e-280	27	683	1	622	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	5.51e-123	45	683	19	644	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.07e-118	45	683	19	644	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	5.69e-118	101	682	67	654	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	7.70e-118	101	682	67	654	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	3.12e-117	101	682	67	654	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000400	0.998893	0.000195	0.000192	0.000166	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000695_00895.