CAZyme Information: MGYG000000695_00896

Basic Information

• Species: Prevotella sp000436035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436035
• CAZyme ID: MGYG000000695_00896
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418	MGYG000000695_8|CGC1	48236.92	8.2617

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000695	3484843	MAG	Kazakhstan	Asia

• Gene Location: Start: 64577; End: 65833 Strand: -

Full Sequence      

MGHTPYDDMKKIFLMFAVASLALQANATAPVYTSIASAQKTMKAAKLTKAKKEVKASKTW
NHEQIVEMIQKVNNYWQTNNKPEVRSFWDNAAYHTGNMEVWKMLKDQKMLDYTIRWAEHN
DWSGATEANPAKWKYKPYGEDKDHVLFGDWQICFQTYIDLYNIEAAKGNAAASEYMVKRA
KEVMHYEAYSEPTDYWWWSDALYMVMPVMTKMYKLTGDVKYLDKLYANLLTTDEIMLDKE
TNLYFRDGKYVYPKHKSANGKKDFWARGDGWVLAGLAKVLQDMPKDYQHYQFFVDKYQKL
AKAVAEIQQPEGYWTRSMMDPDHAPGPETSGTAFFTYGMLWGVNNGYLNKKEYKKTIDRA
WTYLTETALQADGKVGYVQPIGERAIPGQTVDANSQANFGVGAFLLAACEYDKYLTTK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	78	412	7.6e-79	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.91e-83	69	415	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.32e-39	96	411	44	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ79822.1	5.53e-204	57	416	18	370
ADE82673.1	4.52e-203	57	415	18	369
AGB28481.1	4.34e-189	57	415	19	378
BCS84432.1	5.91e-187	65	415	10	363
QQY40390.1	1.16e-177	53	415	20	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	3.57e-168	64	415	32	375	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	5.85e-147	55	415	6	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	2.51e-55	88	410	53	365	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	6.88e-13	195	373	138	322	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.79e-12	195	373	128	312	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	1.64e-54	88	410	60	372	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.40e-51	190	410	151	371	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	1.52e-44	196	410	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	3.77e-12	195	373	138	322	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000344	0.998964	0.000167	0.000169	0.000160	0.000145

TMHMM  Annotations     

start	end
12	34