CAZyme Information: MGYG000000695_01441

Basic Information

• Species: Prevotella sp000436035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436035
• CAZyme ID: MGYG000000695_01441
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731	MGYG000000695_15|CGC2	83788.02	7.8175

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000695	3484843	MAG	Kazakhstan	Asia

• Gene Location: Start: 37368; End: 39563 Strand: -

Full Sequence      

MKKSLLTGIMLCLAMMPATAQRKSQQVEPVLPTPTAKQVEWQKMETYAFIHFGLNTFNDK
EWGYGNSDVKTFNPKKLDCEQWAKTLAAAGMKGVIITAKHHDGFCLWPTHTTDYCIRNTP
YKNGEGDIVGELSKACKKYGLKFGIYLSPWDRNQTSYGSEYYVGYYQRQLKELLSNYGDV
FEVWFDGANGGDGWYGGAQEKRTIDRRNYYQFPKLYQIVDSLQPQATIFGDGGPGCRWVG
NESGFAGETCWSMIPSNTVYPGYPNYKQLQYGWEDGDQWTPAECDVSIRPGWFYHESEDC
KVKTVDELCDLYYKSVGHNATFLLNFPVDKDGLIHPIDSANAVNFHKKILQELAVNVLKG
ITPKVDTSQGKHTGKYITDNQYDTYWASNKRKGASIEFRLPKAKEISRLMLQEYIPLGQR
VKAFSVYYLQGKNWVKLQQKEETTTIGYKRILRFDKIKTNGLRIVFDDARGCPCINNVAA
FEAQKEVNNEKIIFLDDFNTTASIPNPKVWKLCDFNKVAWAQHFEYVKGYENVRVEDGYL
KLKASKTDGHYKNGGIHTIQGFDKNTRVEVRAKLTKRARGLFPAIWQMPINGKPWPKSGE
VDIMEWVQNTPMEFYQTVHTYYINGETGSAGVTNPNRDPNFDVTQFHVYAAERNEDAVIF
YVDGKETFRYNNQNLAKEKMQFPFCDLKFDIILNCSLGGTLNGQPTWPGEIHDEDLPAEM
WVDWVKVIKCK

Enzyme Prediction     

EC	3.2.1.111	3.2.1.51

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	11	343	6.9e-82	0.9132947976878613
GH16	496	727	1.2e-46	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	3.69e-59	23	454	2	403	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
cd08023	GH16_laminarinase_like	5.58e-59	494	727	1	234	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
pfam01120	Alpha_L_fucos	1.49e-36	60	356	68	331	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	1.76e-35	49	337	31	318	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
cd00413	Glyco_hydrolase_16	1.09e-24	496	727	1	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66686.1	3.68e-316	1	481	1	481
BAU19069.1	8.34e-266	91	481	1	391
QUU10154.1	1.79e-249	28	483	27	484
ASM67455.1	1.79e-249	28	483	27	484
QRP58830.1	1.79e-249	28	483	27	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	2.12e-144	23	483	28	465	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
3EYP_A	6.01e-120	34	482	10	455	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
4ZRX_A	5.41e-115	18	484	18	461	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
6T2O_AAA	1.46e-110	490	728	35	273	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2O_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]
6T2P_AAA	4.09e-110	490	728	35	273	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2P_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2Q_AAA Chain AAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2Q_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	7.03e-108	29	506	35	488	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	2.10e-102	29	481	33	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q9ZG90	2.30e-22	491	729	57	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	4.55e-19	491	729	41	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	7.12e-17	492	729	425	680	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002366	0.810138	0.186599	0.000358	0.000263	0.000240

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000695_01441.