CAZyme Information: MGYG000000695_01607

Basic Information

• Species: Prevotella sp000436035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436035
• CAZyme ID: MGYG000000695_01607
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838		95560.6	8.2812

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000695	3484843	MAG	Kazakhstan	Asia

• Gene Location: Start: 39451; End: 41967 Strand: -

Full Sequence      

MKKISMMVMALLMTMQSQAAERFVSFQPGTNVAFTLAKAGKPTHILMDASEDEGIRMAAQ
NLSADFGRVTGKQASIVQTPEKETLIVGSLSSSFVKQMIAKGKLDVTQLKGKREKYLLQV
VEQPLPGVEKALVIAGSDKRGTIYGIYELSRQMGVSPWYWWMDVHTERHSDLYIKKSVYT
DGEPKVEYRGIFINDEWPSYGNWTNKKFGGFNSKMYQHVFELILRLKGNFMWPAMWASAF
FDDDKQNGELANKMGIVMGTSHHEPMDLAQQDWKRRGEGAWNYQTNKNGLLKFWKSGIER
SKNWETLITIGMRGDGDMPMDQSSDNRKLLENVVADQRKLIFEVRGKDASQVPQVWALYK
EVQDYYDQGMKVPDDVTLLLCDDNWGNVRRLPALDAKPRKGGYGMYYHFDYVGAPRCCTW
LNTNSIPRVWEQLNLTYRYGVDKLWIVNVGDLKPMEYPIQFYFDMAWNPDVFYADNLQAH
AVDFCRSVFGEKYAEEAARILRTYAKFNHRVIPEQLTDRTYTMNYGEWERVVGEYNQLVL
DVEALEKAMPQDKQDALFQLLGYPVKACSNLYDMYYAVAMNKLLAKKKNAQANAWADRVE
ACFKKDAALAKQYHEMNGGKWNHMMDQVHIGYQSWNAPKVAGMPKVTRLEGVVSTQSIVL
PKPVAFHLSQPTISNPVFTEKNGYVSMEAEHYTRCTNGKAQWTVIPELGRTLSGVTPMPV
TASVEGMSLEYDMNIVSDGMARIILRFAPTLNFNTKGLRYAISIDGKDEHVVNINGDYDG
ELGTIQKLQVIDSQTYFHLTKGKHTLRIRPLDEAMVLQKIMVNMGGMRKSYLGAPETL

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	33	820	1.3e-278	0.9956958393113343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	182	514	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.95e-52	677	836	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	1.07e-06	26	149	5	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93956.1	0.0	1	838	1	821
QUT92919.1	0.0	19	837	23	828
ALJ61511.1	0.0	19	837	23	828
EDV05080.1	0.0	10	838	30	845
QDO71564.1	0.0	19	838	8	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	3.48e-265	1	837	12	849	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	7.69e-258	34	837	17	834	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	5.48e-255	34	837	16	833	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	1.14e-202	23	833	5	929	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	1.07e-149	54	837	31	963	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000271	0.999018	0.000185	0.000161	0.000162	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000695_01607.