CAZyme Information: MGYG000000696_00226

Basic Information

• Species: Parabacteroides sp900549585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900549585
• CAZyme ID: MGYG000000696_00226
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589	MGYG000000696_2|CGC3	67261.8	7.4614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000696	3184747	MAG	Kazakhstan	Asia

• Gene Location: Start: 113133; End: 114902 Strand: +

Full Sequence      

MAFVLGIYCMNVMAQNDKTFRHTIELGQTVYSIATMYGVSTDAIYKLNPDSKKGIKAGGV
LLIPKQASSFNEGEQTETYTFHTIEHKETLYAVSMKYKIPAQFIVAANPGLSVKTFTAGR
TIRIPLSKNVESLKKEGKALTDAPKTEKVVGDMEYEVKKRETMYSLCRKFDISSYELIKR
NPALKKGVKAGMIIKVPQSKDLAANEQNEVSSESVIQDEATVNAMLNAPKDIKRLSQLKV
ALLLPFNPDNKNAASYRFIEYYEGLLLAVDSLRNQGFSLDLSVYNTGNGTSKIREILTGE
TLPNVDLIIGAVQNDQIKMVADFAKEHHIKYVIPFTSKNDDVLSNECVFQVNTPHSYLYS
KAAERGRLLFAADNIIFVNIPDKDEKKDFIKTFKEELSDHKIAYKEMTYEPERFAETIDS
LYMVEGQRNVIVPTSSSFEALQKIKTPLRLIADSKPERQISLFGYPEWQTYVRDALDDFY
VLDTYIYTNFYADNLSQPMHDFYDKFKTWYSRDLINTYPKYGILGFDTGMYFFGAMKKFG
ANFEDNLDKFRYSCIQTGFDFNRVNTWGGFINTNVFIVHYRKDFTVTRD

Enzyme Prediction     

No EC number prediction in MGYG000000696_00226.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	3.32e-06	22	63	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	1.36e-04	22	64	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	4.77e-04	22	63	2	44	Lysin motif.
pfam01476	LysM	5.76e-04	155	197	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	0.001	80	124	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT18671.1	2.19e-242	15	588	35	598
QJE27971.1	3.10e-242	15	588	35	598
QUT53910.1	3.10e-242	15	588	35	598
QCY56025.1	3.10e-242	15	588	35	598
ABR42587.1	3.10e-242	15	588	35	598

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	3.25e-07	20	129	2	97	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.718216	0.280853	0.000344	0.000256	0.000162	0.000190

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000696_00226.