CAZyme Information: MGYG000000696_00372

Basic Information

• Species: Parabacteroides sp900549585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900549585
• CAZyme ID: MGYG000000696_00372
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000000696_4|CGC1	41795.21	5.1214

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000696	3184747	MAG	Kazakhstan	Asia

• Gene Location: Start: 191; End: 1288 Strand: -

Full Sequence      

MNKFVVLAAFMLLLSACGGHKHTPFETKIHASLERSLTWRNDSTGIWETAGWWNSANLLT
AVIRYADVTKNKGEVLPVIEDVFEKARHYPVADSTGALHHYCDNFINDYYDDEGWWALAW
IDAFRLTNDTKYLKMAEVIFQDMTTGWSDDVHGGGIFWKKNPLHYKNSIANNLFALTAIR
LYNDTGKEEYADWFKKEVNWYLQTGMYNTEINQIEDGLMEDGTPNRKRHYTYNQGVAIAV
LTEMYLYSHDKKFLNMAEDIAKATITKELVNENGILCEMNPNVAKGNDGVQFKGIFIRHL
GFLYETTNNPIYKEFIIKNAESIITKDFDPESMSFGCYWYGPFQAVNAAANSSALECVIE
AQAIY

Enzyme Prediction     

No EC number prediction in MGYG000000696_00372.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	38	351	1.4e-80	0.8491620111731844

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	3.14e-36	52	302	35	290	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	2.73e-26	52	323	46	306	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam00759	Glyco_hydro_9	1.90e-04	80	200	183	290	Glycosyl hydrolase family 9.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK90205.1	1.11e-178	5	361	9	358
QJE28248.1	1.11e-178	5	361	9	358
QIX66371.1	1.20e-178	5	361	9	358
AST52979.1	2.24e-178	5	361	9	358
QUT96026.1	2.24e-178	5	361	9	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	5.35e-34	106	324	87	299	ChainA, Lin0763 protein [Listeria innocua]
6SHD_A	1.95e-25	26	323	63	348	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	4.59e-24	26	323	64	349	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	3.00e-23	26	323	64	349	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4MU9_A	8.06e-17	109	320	116	320	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000064	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000696_00372.