CAZyme Information: MGYG000000696_00476

Basic Information

• Species: Parabacteroides sp900549585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900549585
• CAZyme ID: MGYG000000696_00476
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282		31826.46	9.0835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000696	3184747	MAG	Kazakhstan	Asia

• Gene Location: Start: 9942; End: 10790 Strand: +

Full Sequence      

MVLHSFYFLLLSIIFILNRMKTLLSKGMTLFICLFISFSLYAGDKTSFLKRQFTSSNGYK
LNYRILYPLNYSPDKSYPVILFLHGAGERGNDNEAQLVHGGNMFASYDNQSKYPAIIIAP
QCPEGESWANYKHPKDNNNKREFPAAAGITPAMSAVKEMLDTYISKGIVDTKRIYVTGLS
MGGMGTFDAVCRFPNFFAAAAPICGGANLKRLEQFKGKTAFSIYHGTNDDVVDPAFSRDA
YKSLQKIHADVRYKEYPGVKHNSWDNAFAEPDYLSWMFQHNL

Enzyme Prediction     

No EC number prediction in MGYG000000696_00476.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	58	262	5.7e-31	0.8942731277533039

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	2.61e-40	46	282	158	387	Predicted peptidase [General function prediction only].
COG1506	DAP2	1.43e-15	52	280	369	616	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
pfam02230	Abhydrolase_2	6.82e-10	74	264	11	202	Phospholipase/Carboxylesterase. This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561.
COG0412	DLH	1.96e-09	169	273	109	214	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
TIGR01840	esterase_phb	3.26e-09	78	248	14	198	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61582.1	4.14e-45	63	278	827	1039
ABS60377.1	3.35e-41	60	278	21	241
QDU56037.1	1.04e-29	60	279	800	1004
QJW99051.1	7.97e-25	60	277	43	235
VTR91196.1	2.84e-24	60	279	42	236

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	1.16e-44	58	279	155	377	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	9.33e-19	58	280	18	215	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4Q82_A	3.20e-09	78	277	81	272	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8YG19	1.11e-08	68	233	65	204	Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum OX=4758 GN=xynS20E PE=1 SV=1
P52090	9.38e-07	78	248	66	251	Poly(3-hydroxyalkanoate) depolymerase C OS=Paucimonas lemoignei OX=29443 GN=phaZ1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000009	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000696_00476.