CAZyme Information: MGYG000000696_01993

Basic Information

• Species: Parabacteroides sp900549585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900549585
• CAZyme ID: MGYG000000696_01993
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000000696_30|CGC3	43317.25	8.9792

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000696	3184747	MAG	Kazakhstan	Asia

• Gene Location: Start: 39485; End: 40618 Strand: -

Full Sequence      

MKYYLIAGEASGDLHASNLMRALKSCDEKADFRYFGGDLMKKQGGTLVKHYREMAFMGII
PVLMNLKTIMRNMKVCKEDIRNFHPDVVILVDYPGFNLKIAEFVKKELKLPVHYYISPKI
WAWKQYRIHSFRKYVDYIYSILPFEKEFFHQLRYEVDYVGNPSVDSVEEYKQQRAVDSVS
FRRMNHLDENGIIAILPGSRKQEIRDNLPLMLKVASLHPEYTAVIGGAPGIDPAYYQAYM
GDSPAKIIFNQTYPLLQHAQYALVTSGTATLETALFRVPQVVCYSVTGGKLANWIFAHFF
HTPFISLVNLICGKEVVQELFGGLFTEERIEAELGRLMNDRSYRSKMLGEYEVMAQRLGE
AGAARSAARLIYDRIKH

Enzyme Prediction     

No EC number prediction in MGYG000000696_01993.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	359	7.6e-108	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.45e-93	1	376	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.56e-90	1	373	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.65e-68	4	371	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.25e-59	5	371	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	5.87e-45	1	321	2	299	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR44355.1	2.80e-183	1	373	1	373
QRO15504.1	2.80e-183	1	373	1	373
QCY57761.1	2.80e-183	1	373	1	373
QUT21416.1	2.80e-183	1	373	1	373
QUT93670.1	2.80e-183	1	373	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.16e-30	5	373	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.09e-29	5	373	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	4.66e-59	5	373	9	376	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	5.05e-58	5	376	8	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q3JAC1	1.06e-53	5	370	10	373	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
Q6ALW0	1.11e-52	5	375	14	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
B6J161	1.71e-52	5	375	8	374	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000696_01993.