CAZyme Information: MGYG000000699_00808

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Bulleidia
• CAZyme ID: MGYG000000699_00808
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461		53372.05	4.8645

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000699	1671307	MAG	Kazakhstan	Asia

• Gene Location: Start: 3416; End: 4801 Strand: -

Full Sequence      

METDWTCAYGKGDSLILDFGEHITGTFSIDMTSIGSPVDAPLYIAVKFCEMACEIEEDSS
TYEGWLSSSWFQEERIHKDVLPCTLQLERRYSFHYVRIDVLDTSPKWKVVFSHPVADAIS
SAKEAEIPCMEDVQLQKIYATGLHTLHECMQDVFEDGPKRDRRLWLGDLRLQALSNYASY
RKTDIVKRCIALFCGMRCKDGRVPANVFVKPAYIPDDTFLYDYSLFLISTVYDYIHETKD
IAFLKTIYPVLTEDMDACLQCVDDTGRFHMQKEFPVFVDWADTFDKEVCGSAVTIYALRQ
LISLGKQMEQDVERYVSMLHKMEDEIRTHLYDQKEHIIRCYSKEINLATQVWMVLSSTFT
KEENHAIMQEAVKRFFPVQGIATPYMYHHITEALFVSGMKEEAVTLMKSYWGKMIDLGGD
TFFEAFDPDHPDYSPYGSAMINSYCHAWSCTPVYLIRKYIL

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	13	461	1.8e-67	0.8611111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	9.28e-13	135	460	13	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17167	Glyco_hydro_36	7.95e-07	217	403	122	337	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
pfam06202	GDE_C	1.50e-05	187	339	53	219	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE12985.1	1.45e-190	9	461	67	521
ARE15392.1	1.45e-190	9	461	67	521
ALO05363.1	1.19e-184	11	461	71	525
SQI09408.1	1.74e-184	9	460	67	522
BAK30773.1	1.74e-184	9	460	67	522

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XHC_A	1.65e-127	11	459	91	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
3CIH_A	2.02e-26	132	461	308	637	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.99e-19	90	461	502	877	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000699_00808.