CAZyme Information: MGYG000000700_01835

Basic Information

• Species: UBA4372 sp900543815
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA4372; UBA4372 sp900543815
• CAZyme ID: MGYG000000700_01835
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
738		84381.77	6.4568

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000700	2636252	MAG	Kazakhstan	Asia

• Gene Location: Start: 4395; End: 6611 Strand: -

Full Sequence      

MVRKLISALLLLSVTLGTYATEWKGKFLILEHSQSRPNTWALWRKNFNVDKVPSSVKARI
ATDTKYWLYINERLVVFEGGLKRGPEPNATYYDEVEIAPYLQEGDNLIAVLTWHFGLNGF
SHVNSGTSGLLFEAEGDGVQVVSDKTWRGAMYGAYGETDAPKPNYRISESNIRFDGRKEE
KGWYTRAYTYGLEEVLPVDVENCPLGKLVKRPIPLFKDSGLLDFKSKEMKGDTLVCTLPY
NCQCTPYIKLRSQKAGQLVKIQTDVHMIGGSPTVRCEYITREGEQEYENMGWFNGHQIWY
ILPEGVEVLDVKYRESGYGCDMVEPFHCDDPFFNELWIRAQRTLYITMRDNYMDCPDRER
GQWWGDAVNELGEAYYALTPDGNKLGMKALNELFCWQRGDGVLYSPVPAGNWNKELPSQI
LATTGWYGIYMQCYYANDFSVARRHYDRLHRYLHEVWKTDADGLAILRHGDWFWGDWGEN
IDQLLLQNAWYYLALKGELELARLFGKSDDVQTIQTMMKRMEDNFDHRFWTGSSYRSPDY
KGETDDRGNALAVVSGLASKDKFPALKTLLTTEYHASPYMEKYVLEALFCMDATDEALDR
IRKRYKTMVEYPGLTTLPENWIDETKQLKPGEPMINAFWGTYNHGWSGGPLTLLSQKVCG
IEPTSPGFRTFRIRPQMGYLKQASCHVSSVSGEISVNIQRKGKKLQIDVTVPSGTTAEVV
FPSGKTKTLQSGTHSIRG

Enzyme Prediction     

No EC number prediction in MGYG000000700_01835.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	275	720	3.6e-85	0.8829365079365079
CBM67	32	188	2.3e-26	0.8465909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.10e-18	326	658	6	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.43e-14	660	734	1	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	0.002	92	214	46	166	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCD18940.1	3.49e-316	24	734	280	981
QUT54419.1	2.51e-309	20	736	29	738
BBK91319.1	1.03e-308	23	736	13	719
QUT48047.1	1.97e-308	9	737	9	730
ABR43077.1	2.80e-308	23	736	31	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.36e-17	326	706	304	684	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000689	0.998408	0.000208	0.000248	0.000216	0.000208

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000700_01835.