CAZyme Information: MGYG000000700_01846

Basic Information

• Species: UBA4372 sp900543815
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA4372; UBA4372 sp900543815
• CAZyme ID: MGYG000000700_01846
• CAZy Family: GH18
• CAZyme Description: Chitinase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244		27421.77	4.4874

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000700	2636252	MAG	Kazakhstan	Asia

• Gene Location: Start: 5206; End: 5940 Strand: -

Full Sequence      

MGGAGQEAGWGEMTGCDSLRAAFAADCKRVVDKYGLDGLDFDWEFPQGDQQDNYVKLFKD
VREVLGPDKRVTAAVGSFGNGFDLREAKKYLDYINLMSYDMGWQAPYHHTSLRRSELSGV
CTLEEAIDSCLNKGLDYKDIVVGLAFYGRGDGTNFKDWTDYRDIVNRDLAAEGMEERWDS
VACVPYIVDSLGTLIVGYENPRSLKIKCDYIKEKGLKGGMYWRTELDTDSFDLTNAVARE
LLGR

Enzyme Prediction     

No EC number prediction in MGYG000000700_01846.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	2	229	2.1e-50	0.7331081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	2.47e-54	2	229	92	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
pfam00704	Glyco_hydro_18	1.30e-53	2	229	71	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	1.89e-47	9	229	75	334	Glyco_18 domain.
cd02872	GH18_chitolectin_chitotriosidase	1.19e-40	9	241	79	362	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	2.41e-33	2	241	134	436	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL06865.1	1.06e-142	1	244	100	344
AIF26577.1	7.82e-60	9	238	105	345
ADV45176.1	9.12e-58	9	242	99	340
QBQ40121.1	2.28e-57	9	244	98	342
QUT34047.1	4.89e-57	9	244	99	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QOK_A	3.05e-28	20	241	132	412	ChainA, Putative chitinase II [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
6KST_A	6.10e-27	1	242	82	371	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXN_A	6.10e-27	1	242	82	371	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6INX_A	2.99e-26	9	227	76	329	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
4NZC_A	3.09e-26	20	241	112	396	Crystalstructure of Chitinase D from Serratia proteamaculans at 1.45 Angstrom resolution [Serratia proteamaculans 568],4Q22_A Crystal structure of Chitinase D from Serratia proteamaculans in complex with N-acetyl glucosamine at 1.93 Angstrom resolution [Serratia proteamaculans 568]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q92222	2.19e-19	15	227	109	347	Endochitinase B OS=Emericella nidulans OX=162425 GN=chiB PE=1 SV=3
G5EAZ3	2.19e-19	15	227	109	347	Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiB PE=1 SV=1
P36362	2.78e-19	9	227	104	375	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
Q873X9	1.28e-18	17	243	150	406	Endochitinase B1 OS=Neosartorya fumigata OX=746128 GN=chiB1 PE=1 SV=1
E9QRF2	1.28e-18	17	243	150	406	Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiB1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000700_01846.