CAZyme Information: MGYG000000701_01518

Basic Information

• Species: Prevotella sp900552675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900552675
• CAZyme ID: MGYG000000701_01518
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000000701_25|CGC1	44953.68	5.9994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000701	3061545	MAG	Kazakhstan	Asia

• Gene Location: Start: 4251; End: 5438 Strand: -

Full Sequence      

MILKKIFNASLLVSLILLASCSSANDEPAGKKEPDASAVNTLSITDKEATAETKALYANL
WKVQQTGFMFGHHDDLTYGRYWQYEDGNSDTKQVCGDYPAVYSVDVAEVMDNRAETQAEV
NAIRKRCIEQAYNRGMVVVACMHLNNPLTGGDAWDNSSNQVAKQILTNGSPTQAIYNSWL
NNLVAFAHGLKGNDGKLIPLIFRPFHEHTQSWSWWGNQCTTEAEFVALWRYTVDYLRQAG
AHQFIYAISPQMDTPKTMNDFAYRWPGDDYVDFIGMDCYNNGVATTMSTNMRMLQKVSEA
KLKPCGITETGVEGFTDKKYWTEQILAPYERRKLSMVITWRNKYVNGDEQDKHYFSVYKG
HPSEANFIRFYNDPHTLFCADLKDMYTMPEGFTIK

Enzyme Prediction     

No EC number prediction in MGYG000000701_01518.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	46	357	1.7e-58	0.9570957095709571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.34e-27	46	284	2	235	Glycosyl hydrolase family 26.
COG4124	ManB2	5.22e-14	176	374	160	342	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60278.1	7.98e-179	3	395	1	390
QUT88729.1	4.59e-178	3	395	1	390
ADB80106.1	7.69e-162	3	395	2	388
QUT31668.1	5.57e-156	3	395	1	394
QGT72560.1	7.89e-156	3	395	1	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	2.03e-75	48	388	7	345	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
4CD4_A	2.80e-62	9	386	12	418	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX4_A	1.69e-61	43	386	32	395	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	1.69e-61	43	386	32	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX7_A	1.30e-60	43	386	32	395	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	9.55e-49	13	389	20	418	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	7.15e-35	40	380	38	396	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
G2Q4H7	1.98e-11	43	349	173	454	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
O05512	4.34e-10	92	279	80	268	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P49425	1.17e-08	44	321	146	422	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000153	0.999894	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000701_01518.