CAZyme Information: MGYG000000701_01624

Basic Information

• Species: Prevotella sp900552675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900552675
• CAZyme ID: MGYG000000701_01624
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411	MGYG000000701_27|CGC1	46453.36	7.6683

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000701	3061545	MAG	Kazakhstan	Asia

• Gene Location: Start: 34668; End: 35903 Strand: +

Full Sequence      

MKFFKISLIIVSIFTTVSCHADTPLMGAVSAPNASGGSATPNQTTIPTAQQWNKNVVGWN
LGNNFECSAPGQDGETLEISNPTGAINAETAWGNARVTRKVITAVKKAGFNAVRIPIRWQ
CHITNAQAMSIDKAWMARIKEVVGWCLDNDLKVIINVHHEKWLESRPTYKYKEENCQKLA
LLWMNIASEFAQYDYRLAFAGTNEVHIKNNWNQPTAENLEVQNAYNQTFIDVVRATGGNN
LQRHLIVQTYVCNPSFGLDNGGFIIPTDVDGNGNKYMSVEFHYYQPWDYAGEGKYDYWGD
VYKQYGKTPSDNEQTLTLFFDRVANVWGSKGLGIVIGEWGVTDHYKSNADKVHENMTYYC
KTFVTAARQRGFSTFIWDNNSFGNGKEKYGIFDRFKSMQIKAPWIINGIFQ

Enzyme Prediction     

No EC number prediction in MGYG000000701_01624.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	89	380	3e-86	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.29e-44	85	383	12	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	5.86e-21	26	396	23	377	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT65075.1	3.68e-239	2	410	4	403
ASE18437.1	5.65e-238	5	410	7	401
ADK97059.1	5.65e-238	5	410	7	401
QKH87838.1	5.65e-238	1	410	3	401
QUB91389.1	1.14e-237	5	410	7	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EDG_A	4.79e-69	57	409	31	371	SingleCrystal Structure Determination Of The Catalytic Domain Of Celcca Carried Out At 15 Degree C [Ruminiclostridium cellulolyticum H10]
6WQP_A	3.99e-59	41	394	8	338	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
4X0V_A	1.17e-53	57	411	49	393	Structureof a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_B Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_C Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_D Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_E Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_F Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_G Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_H Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32]
5H4R_A	3.20e-53	57	411	49	393	thecomplex of Glycoside Hydrolase 5 Lichenase from Caldicellulosiruptor sp. F32 E188Q mutant and cellotetraose [Caldicellulosiruptor sp. F32]
3NDY_A	6.86e-53	46	411	10	339	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P17901	1.12e-67	33	409	25	396	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1
P28623	1.50e-53	29	411	24	370	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
O08342	1.09e-50	38	411	30	397	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P54937	1.68e-49	57	394	48	360	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P28621	5.38e-49	5	411	9	372	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000945	0.429375	0.568933	0.000372	0.000195	0.000167

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000701_01624.