CAZyme Information: MGYG000000706_00054

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; UMGS1326
• CAZyme ID: MGYG000000706_00054
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	MGYG000000706_1|CGC2	36626.83	5.9196

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000706	2490616	MAG	Kazakhstan	Asia

• Gene Location: Start: 60694; End: 61686 Strand: -

Full Sequence      

MASGWLVYQLFDGYEYTLDKEYLKEIYPIAKEASEFYLDMLSEVDGYLTLMSSSSPENKF
LLDGKKVSMTKMSTITVSIIRELFEKVIETGSILGADIEFCDKLRSVMSRLYPFKIGNDG
RLLEWYGEKTKVDPQHRHVSHLFSLYPGHDISVDNTPELAEACRKTLGKRGDGGTGWSLA
WKINFWAMLHDGNHTLRLLNNQLTLCNPKKELSINGGGTYPNMLDAHPTFQIDGNFGAAV
GIANMLLQSESGKISVLPALPDSWRSGSFSGLCAKGNITVSASWNDGKVTELTLETPVPQ
TVIIKVNGTETELRLEANIKSVVPLSNRGF

Enzyme Prediction     

No EC number prediction in MGYG000000706_00054.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	1	312	1.4e-116	0.41274238227146814

CDD Domains     

MGYG000000706_00054 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50631.1	6.30e-98	2	322	463	786
QIX67531.1	4.81e-97	2	322	463	786
QUR47708.1	4.81e-97	2	322	463	786
BBK92411.1	5.02e-97	2	322	465	788
AOC96525.1	3.47e-96	1	305	478	784

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UFC_A	7.98e-72	2	329	444	778	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
2RDY_A	1.00e-70	5	312	452	762	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
7KMQ_A	3.02e-64	1	294	464	747	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2EAB_A	1.75e-41	2	308	507	853	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	1.75e-41	2	308	507	853	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	1.28e-67	1	294	505	802	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	5.95e-28	2	291	463	763	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	3.35e-22	2	285	482	776	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000706_00054.