CAZyme Information: MGYG000000706_00898

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; UMGS1326
• CAZyme ID: MGYG000000706_00898
• CAZy Family: PL15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1146		129860.42	4.6184

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000706	2490616	MAG	Kazakhstan	Asia

• Gene Location: Start: 119027; End: 122467 Strand: +

Full Sequence      

MKINKFISIFLIISIISSVFSVSVSAADKDLNYAVVGNDNREMPFRPEDKYVSQQNPPTF
LWPKVKNIDSYELVVCSDKELKDVKYRKDGIKTNFYSFDCIFETGVQYYWAVRTKKGSKV
SEWSDARRFRIDPDAVEFPVEDIEVLAEKIPQSHPRIYATPETLEDFRNMKNKNATAKKV
YDTYMKKANDYIKNGTFPDEPVEPNHASEADKVVWGLKLVGEANKLIDIVKSCGFAYLLS
GDEKIGRFGVEALVELSGWDIYGVTSYENQDQVHRMIAYESAKAYDWLYPIMTEDERQTA
LDMITERTKIMEYLLDELKDSPYESHGWTAFGYIGIVAIATYRDVPEAEKWLKTIVPAYT
AMLPVWSYEDGGWSQGTDYWQYSSTFNKEFMEVVKLVGMTDMYKKAWQQNEYLWQMYAYP
EGSFGSFGDQSNWNKASSVYSGKAMINMAAFTGNGYAKWLAGRFEEPTVDVRSYVSAISN
SVEEKSPKDFPLAHEFSDIGWAIMTDDVINPDRIQLSFKSSPYGSFNHSEADQNSFIIQA
YGENLAVKSGWYDYYHSTHNSGFTRKTSAHNSVTVATNRGQRDDSFNSKGKLTNFLNHVD
FDLVSGDATQAYFGALDKFERSIVYIRPDIFVVIDNLDAAGSEKSQFEWWLQANHDIEVY
DNLNGARLTEGIAVLDAIVQYPQKVKTYYNNTYAASDMKEYPTDRYKDFNVQRRVWFETE
KVENTKMVVTMDVHKSGTEARFVDTEYYNDYVKMTFEDGTIMLVNLKNNDEVVRANDIIF
KGAAVVYNDESVMLVSGTTLSMGGIELIKNKEAASVVIGKNEMGISTYEDNQISINVNND
YISEISSVTDYNGRHIGKEYGIYMESGIIKEKTAEEKVEYIIEDKPDYVTFTAEKDNYTL
MLNGNKFVSESVEGSLKLSIDGKITDYVINGQTKRDGGVSFSGNISFPASKYFVKNKNKE
LNFNGINTGDNAVLSSATVSSSVKDNFIELEKVKSIPVSNVAESDVESAKNRMTVFVEAE
DYTDNIADGAKVYNTRAFMSGGAGVHLFNTPGTQMKYKFNVPESGKYSLAITYVTFGDDP
TIRSYNINGIDYEMTLEKTAGYGVVPDDWKTAICNNEVELEKGEYIISLEAIGGNWNIDW
LGLIKR

Enzyme Prediction     

No EC number prediction in MGYG000000706_00898.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL15	512	637	5.5e-32	0.9477611940298507

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16332	DUF4962	6.27e-33	41	463	8	447	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.
pfam07940	Hepar_II_III	4.20e-17	491	669	4	180	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
cd04086	CBM35_mannanase-like	1.20e-09	1017	1139	3	114	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
cd04083	CBM35_Lmo2446-like	1.64e-05	1018	1141	4	123	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd02795	CBM6-CBM35-CBM36_like	2.13e-05	1017	1143	2	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK58733.1	1.00e-194	43	1143	52	1129
ASV74042.1	7.46e-71	16	693	17	704
APH03943.1	1.03e-66	42	661	13	659
APH04986.1	1.07e-65	42	766	13	755
QDV65465.1	3.66e-65	45	658	95	719

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A0O_A	2.51e-59	45	649	26	657	Crystalstructure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58],3A0O_B Crystal structure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58]
3AFL_A	4.87e-58	45	649	26	657	Crystalstructure of exotype alginate lyase Atu3025 H531A complexed with alginate trisaccharide [Agrobacterium fabrum str. C58]
6LJA_A	2.10e-37	24	659	26	706	ChainA, Heparinase II/III-like protein [Bacteroides intestinalis DSM 17393]
6LJL_A	4.17e-35	24	659	26	706	ChainA, Heparinase II/III-like protein [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000383	0.998916	0.000193	0.000168	0.000166	0.000152

TMHMM  Annotations     

start	end
7	26