CAZyme Information: MGYG000000706_01407

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; UMGS1326
• CAZyme ID: MGYG000000706_01407
• CAZy Family: PL15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1195		134227.87	4.6405

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000706	2490616	MAG	Kazakhstan	Asia

• Gene Location: Start: 74174; End: 77761 Strand: +

Full Sequence      

MKSKRIISFILAAVMSITAFGVLAYAAPGGEETWSYEQQASGLNTPFRPSDKYVCEQNAP
DFLWPHVSSAKKYDLIVCSDSELKDIKYSAYDITNNFYTFPTTFETGVYYYWAVRYFDGK
EYSEWSNARRFKIKPDAYEFVYPGADALMAKIPKSHPRIYFTQDTLEDMRSWKDTNADCK
RIYDSIISKAHEYVEANYIPKEPVLQRDANDDGKNAAFQQQIVRDARELYGQVTTCGQAY
QFTGDKEIGKYGVKCLVELSKWDINGDTSYTSQDQVHRAIALNAAIGYDMLQDLMTESEK
KQVIKMVVERTKVMEYLLDSLAKSSYDSHGWTAYGFIGIIALALYGDAPEAENWLRTVFD
GYTAMLPPWSYEDGGWSQGTDYWRYSSSTNKEIVEVLALAGIIDLNQKAWCRNEYLWMLY
AYPPNSYGSFGDQANRTKSSMEYSGNIAGRQLAFDRGNEVLKWLYDQWGGSENMDGIVGY
YVAKMVENVNSQEPMTYPLAHEFSDVGWTVMSDDLIDPNRIQCTFKSSYYGSYNHSHPDQ
NSFIIQAYGENLAIKSGYYDSYHSKHDSGFTRKTGAHNSVTIADSKGQVDDDFNAKGKLT
GFLNQIDFDMSAGDATQAYKGELDKFERCMLYIRPDIFVVIDELDAKDKDKRKFEWWLNA
EHDIKTYDDGAGARLQEGSAVLDAKVQYPSSGVKTFYNNTFALSDMTIYPATGQYANYNV
QRRVWFQTPKVDRTKMIVTMDVHRDGTEARYVDTEEHEDYVKMTFADGTVVLVNTQKPGK
TVTTDEEISFDGTAVMYNDRSIMLALGTFLKWGDKELIRCEDRASVVMGGNELSISTYTD
QKISVDTENEYINGITKVTDYNGNEISKAYGIAMENGMLIPNSEVGSKETIASKTIEKKI
RSRWDIGIPATTSAPSENSAKDAVDEIKTTYMVDPSKSGITFDADMDNYTLMLNGKLVSS
SKDKGSIKIKIDGEVKESTELTGYMRRDGSFSYNGKLSLDGRKYIVKSINDGLSAGLKVG
DVKGITELTISSTKADNVIELETVPVNELAVDQISDHESVKNAATVFIEAESAEEIGSGN
VYNTREFMSGGAGITKHDTAGTNLVYTVNIPEDGDYTLSLDYVAWEEAGARRGVTIDDKV
YEITLPKTASWGADSADWRAAVGKDTIHLNQGTYTLKIEAISGMWNLDWIAFTKK

Enzyme Prediction     

No EC number prediction in MGYG000000706_01407.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL15	515	644	2e-32	0.9776119402985075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16332	DUF4962	3.89e-30	45	433	10	414	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.
cd04080	CBM6_cellulase-like	1.13e-13	1104	1193	59	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
pfam07940	Hepar_II_III	1.34e-13	498	656	4	160	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
cd04083	CBM35_Lmo2446-like	3.02e-09	1069	1192	4	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04079	CBM6_agarase-like	9.36e-08	1063	1194	1	134	Carbohydrate Binding Module 6 (CBM6); appended mainly to glycoside hydrolase (GH) family 16 alpha- and beta agarases. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family 16 agarases. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the activity of alpha- and beta-agarase catalytic modules which are involved in the hydrolysis of 1,4-beta-D-galactosidic linkages. These CBM6s bind specifically to the non-reducing end of agarose chains, recognizing only the first repeat of the disaccharide, and directing the appended catalytic modules to areas of the plant cell wall attacked by beta-agarases. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. This family includes three tandem CBM6s from the Saccharophagus degradans agarase Aga86E, and three tandem CBM6s from Vibrio sp. strain PO-303 AgaA; in both these proteins these are appended to a GH16 domain. Vibrio AgaA also contains a Big-2-like protein-protein interaction domain. This family also includes two tandem CBM6s from an endo-type beta-agarase from a deep-sea Microbulbifer-like isolate, which are appended to a GH16 domain, and two of three CBM6s of Alteromonas agarilytica AgaA alpha-agarase, which are appended to a GH96 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK58733.1	1.43e-163	6	1190	14	1127
ANK82807.1	2.10e-62	28	670	37	681
ASV74042.1	2.07e-60	47	675	48	681
QTN01574.1	2.42e-60	36	692	5	680
QCT03372.1	5.31e-59	36	777	9	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A0O_A	4.43e-57	37	656	16	657	Crystalstructure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58],3A0O_B Crystal structure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58]
3AFL_A	8.35e-56	37	656	16	657	Crystalstructure of exotype alginate lyase Atu3025 H531A complexed with alginate trisaccharide [Agrobacterium fabrum str. C58]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000481	0.998723	0.000209	0.000224	0.000176	0.000153

TMHMM  Annotations     

start	end
7	29