CAZyme Information: MGYG000000706_01894

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; UMGS1326
• CAZyme ID: MGYG000000706_01894
• CAZy Family: PL15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1190		133689.69	4.7354

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000706	2490616	MAG	Kazakhstan	Asia

• Gene Location: Start: 6119; End: 9691 Strand: -

Full Sequence      

MKFKKILKAAVCVALCLVMLSGTGVFAAIGTSDGSSSSAEPWDTNYNPTNINMMPFTPED
GYVAQQNPPSFKWGNVDGATSYEVVVAADPELKDIRYRKDGIKYNYYNFDTTFETGVHYY
WAVRYYKGDNPSSWSKVRKFRIDPDAYQYAFPDIETIKNRIPKGHPRLLATAETLEAFRA
KKDKSEAAKQVYDRAIAQADQYILTEIDKEPADESKTIADPVKRHEWLLGVRRKTKPILD
KAVGCAFAYLLTGDEKYGRYSIDCLLEASTWDINGVTSYETQDQIHREFAFWTAVAYDWD
YSMMTDSEKESVLKMISDRTEVMEYLLESLKKSPYDSHGYTAYGYIGVVALATVGDIPKA
ETWLEKTIIGFSALTPVWGYEDGWSQGVAYWSYDPPSVDWFMPFLAATGYANLYGLAYSQ
NQYLYYMYNNPPGSWGGFGDESGRTLHDSACLKISSYDSYFTKNPVTRWLAEQYGYVPGV
SKSLTWFDYLIADDDTKPEEPVTYQLSHEFQDIGWVSMMDSIKDKDRIKLMFKSSPFGSY
NHSHPDQNSFLLEAYGQPLLVNSGYYDSYHSAHDSGFTRRTGAHNCVTIADSIGQRDDDF
SAKGHLTGYLTQQDFDLASGNATEAYKGEIGNFERNIVYIRPDIFVIVDDLKAGEKNKTS
QFEWWLNSRVPISLYKDGNGARIENSGAVVDATVQYPQKVKSYYNNMNALSDMVEINPGG
RYASSAADTRVWFETEDTAATKMIVTLDVHRSAKEARFVDTEYNKSYVKMTFEDGTIMYV
NLGDNDKEVVTKEGISFTGALVVMNGESIMLSGGTNLKIGGKDIVVLERQGSVVLGVNEL
SISTYSDNRISVNTDNEYIQGIEKINDYNGRELRAEIGITYENGKLEKGTSGEEVKADDS
KKIETKNKNGDKKASETEQKPVFNVVPKDKYITFTAEKDNYQLMLNGKTINTDKHEATAT
VKIDGEEKTVKLEGIMGRNGKIKYSGIFDGEDDKYKCVGISDNLNAGAVGKDKVSVIGKL
SLSAQTDKDLWLELIRVPINKPEAEAIDDYDTLKDKLTVFKEGEECEKPLATGAEIYGNR
PFLSGALGISGFNDPKTEMVYKVEIPEEGDYDFAVKYVAWEEGGAVRSFTINDVTYVYTL
DKTVDYGTVPESWKAMFVKSGIHLQAGVYELRMGVLSGSWNYDWFGFVKK

Enzyme Prediction     

No EC number prediction in MGYG000000706_01894.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL15	522	651	6.5e-32	0.9776119402985075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16332	DUF4962	7.61e-29	58	487	13	470	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.
pfam07940	Hepar_II_III	7.32e-19	507	689	6	187	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
cd04080	CBM6_cellulase-like	2.48e-07	1099	1188	59	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
cd04086	CBM35_mannanase-like	0.010	1065	1119	4	58	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK58733.1	1.44e-179	53	1186	51	1128
ASV74042.1	8.47e-70	56	755	48	744
ANK82807.1	3.44e-63	54	680	54	681
AXA35159.1	1.99e-62	56	694	69	720
AKU22032.1	3.71e-58	58	733	40	708

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A0O_A	7.31e-44	56	655	26	651	Crystalstructure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58],3A0O_B Crystal structure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58]
3AFL_A	1.27e-42	56	655	26	651	Crystalstructure of exotype alginate lyase Atu3025 H531A complexed with alginate trisaccharide [Agrobacterium fabrum str. C58]
6LJA_A	1.37e-34	57	683	42	719	ChainA, Heparinase II/III-like protein [Bacteroides intestinalis DSM 17393]
6LJL_A	2.65e-32	57	683	42	719	ChainA, Heparinase II/III-like protein [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000318	0.998814	0.000340	0.000177	0.000172	0.000159

TMHMM  Annotations     

start	end
7	29