CAZyme Information: MGYG000000707_00210

Basic Information

• Species: Prevotella sp900546575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900546575
• CAZyme ID: MGYG000000707_00210
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	MGYG000000707_3|CGC1	39174.83	10.1965

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000707	3151200	MAG	Kazakhstan	Asia

• Gene Location: Start: 45481; End: 46494 Strand: +

Full Sequence      

MLKSSNFAFTSQNKCVKYKIKQITTKNHMNTLKKTAYILIMCIVFGSSAAIAQMKWNSAY
KAYVDQYKDLAIEQMLRYNIPASITLAQGLLESAAGRSDLTRAGNNHFGIKCHGWTGRRV
YHDDDARGECFRAYDNARQSYEDHSRFLATQSRYARLFDYKRTDYRSWARGLKACGYATN
PQYATKLIQIIELYNLSCYDRATSYDRFMARHVSTDKPAPDGSLHVVKFYNKNYYVIAKT
GDTFKELARETGISARKLARYNERNKKDVLAQGDVVYLKKKQKRAEKQYRRTPHVVRAGE
SMYFIAQLYGIRLKSLYKMNHLEPDYEIQVGDRLRVR

Enzyme Prediction     

No EC number prediction in MGYG000000707_00210.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	69	196	8.5e-34	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	5.96e-39	71	200	171	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	4.11e-33	47	205	30	193	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	6.24e-28	53	206	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	4.66e-26	68	196	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12711	flgJ	4.51e-19	56	190	223	354	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66218.1	5.15e-147	29	337	1	307
VEH15664.1	7.06e-147	32	336	1	305
AGB29226.1	2.16e-146	50	336	20	307
ALO49150.1	5.77e-141	33	336	3	304
BCS86660.1	4.26e-139	51	336	1	287

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	1.68e-12	61	191	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.01e-12	61	191	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.31e-11	61	191	3	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3FI7_A	1.23e-07	61	200	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	5.88e-15	82	337	202	473	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9X9J3	6.63e-11	61	190	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
O32083	2.41e-10	77	200	65	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.540512	0.451485	0.006164	0.000561	0.000428	0.000843

TMHMM  Annotations     

start	end
35	52