CAZyme Information: MGYG000000707_01889

Basic Information

• Species: Prevotella sp900546575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900546575
• CAZyme ID: MGYG000000707_01889
• CAZy Family: GT92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
300		35203.1	9.3122

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000707	3151200	MAG	Kazakhstan	Asia

• Gene Location: Start: 13932; End: 14834 Strand: -

Full Sequence      

MHKVLAEIIAGVIPHKMTRNQWRGILRFGVFNAIKLNIDIRRNHTTPEHHLAVCAIAKNE
GPYFKEWVEWHLSQGVDKFYVYDNESTDGTKQILEPYIKQGIVEYIDWPGYRRQLAAYDD
CLKRHRFDTRWIAFIDLDEFIVPIKDASIPDFLKRFEQFPAVEINWLVYGSGGNKAKSSE
PVMKRFRFHSQPDHYLNRHVKSIVNPRMVYTMIGCHEVARIKGKAADSHGNPITRNFRQR
TPQQDVIRINHYAVRSLEEFREKQMRGRASGTQTSVPMEYFNQYDLNDIEEPAPDISQNK

Enzyme Prediction     

No EC number prediction in MGYG000000707_01889.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT92	49	268	1.5e-32	0.8172043010752689

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01697	Glyco_transf_92	9.06e-30	63	218	19	188	Glycosyltransferase family 92. Members of this family act as galactosyltransferases, belonging to glycosyltransferase family 92. The aligned region contains several conserved cysteine residues and several charged residues that may be catalytic residues. This is supported by the inclusion of this family in the GT-A glycosyl transferase superfamily.
pfam13704	Glyco_tranf_2_4	9.50e-18	58	153	1	97	Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,
pfam00535	Glycos_transf_2	8.65e-07	53	210	2	159	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02511	Beta4Glucosyltransferase	2.14e-04	51	266	2	178	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD39434.1	1.48e-163	1	291	1	291
QCP73126.1	1.48e-163	1	291	1	291
QPH38826.1	2.11e-143	3	291	37	325
SCD19281.1	8.17e-140	1	290	31	320
ADY36745.1	5.25e-138	1	291	1	290

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9SLR1	3.30e-17	4	263	219	483	Glycosyltransferase family 92 protein RCOM_0530710 OS=Ricinus communis OX=3988 GN=RCOM_0530710 PE=3 SV=1
Q94K98	6.71e-16	37	263	279	502	Glycosyltransferase family 92 protein At1g27200 OS=Arabidopsis thaliana OX=3702 GN=At1g27200 PE=2 SV=2
Q6YRM6	1.23e-15	49	162	314	428	Glycosyltransferase family 92 protein Os08g0121900 OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0121900 PE=2 SV=1
B9S2H4	6.16e-13	48	266	294	509	Glycosyltransferase family 92 protein RCOM_0530710 OS=Ricinus communis OX=3988 GN=RCOM_0699480 PE=3 SV=1
O65431	2.20e-07	65	159	260	367	Galactan beta-1,4-galactosyltransferase GALS3 OS=Arabidopsis thaliana OX=3702 GN=GALS3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000707_01889.