CAZyme Information: MGYG000000707_02036

Basic Information

• Species: Prevotella sp900546575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900546575
• CAZyme ID: MGYG000000707_02036
• CAZy Family: GH16
• CAZyme Description: Kappa-carrageenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324		37774.78	9.1895

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000707	3151200	MAG	Kazakhstan	Asia

• Gene Location: Start: 2728; End: 3702 Strand: -

Full Sequence      

MKSYFIGFVLSLSSMSCFAQQIPSYRMTPYNSNVFTKNDAFSDEFNDTAVDKKKWRTPYD
DSFATWTFVSENVRQQNGILQLMMSYDRHTRKRGKKQIDLYFNSGMLRSIDKVGYGYYEA
RVKGSPVWPGTCSAFWMYTIPNESKKMAKQAPNTIIYNEIDAIELQQEPKSKDILSCNMH
VWVFDDNLKTKRLMASQYPQLGKNEITIKDWNGEKSFHTYAVENRPDSVVFYIDNKRVAA
KPNYFWHKDMHLILSLGLRTPFEKYANGARMTVPTTQEQAASSGFPCTMEVDYIRSWTRD
YSKFPSSQIDYSDDVIQKITRNNQ

Enzyme Prediction     

No EC number prediction in MGYG000000707_02036.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	42	297	3.6e-70	0.9961389961389961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02177	GH16_kappa_carrageenase	9.55e-48	42	297	15	268	Kappa-carrageenase, member of glycosyl hydrolase family 16. Kappa-carrageenase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of kappa-carrageenans, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Carrageenans are linear chains of galactose units linked by alternating D-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Depending on the position and number of sulfate ester modifications they are subdivided into kappa-, iota-, and lambda-carrageenases, kappa being modified once. Carrageenans form thermo-reversible gels widely used for industrial applications. Kappa-carrageenases exist in bacteria belonging to at least three phylogenetically distant branches, including pseudoalteromonas, planctomycetes, and baceroidetes. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd08023	GH16_laminarinase_like	2.58e-28	41	295	1	233	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	4.52e-26	43	297	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02178	GH16_beta_agarase	8.35e-22	38	297	22	257	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd02175	GH16_lichenase	2.13e-10	65	238	28	161	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EIY64570.1	7.41e-112	21	319	63	368
QUT23324.1	1.29e-88	20	312	72	363
QDT88733.1	4.02e-58	29	299	40	313
ARD46027.1	2.62e-55	23	299	31	319
QDT10653.1	7.73e-55	42	307	82	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OCR_A	3.97e-41	42	299	28	285	Crystalstructure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans],5OCR_B Crystal structure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans],5OCR_C Crystal structure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans],5OCR_D Crystal structure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans]
5OCQ_A	1.71e-38	42	299	22	272	Crystalstructure of the complex of the kappa-carrageenase from Pseudoalteromonas carrageenovora with an oligotetrasaccharide of kappa-carrageenan [Pseudoalteromonas carrageenovora],5OCQ_B Crystal structure of the complex of the kappa-carrageenase from Pseudoalteromonas carrageenovora with an oligotetrasaccharide of kappa-carrageenan [Pseudoalteromonas carrageenovora]
1DYP_A	3.97e-35	42	299	20	270	1,3-Alpha-1,4-Beta-D-Galactose-4-Sulfate-3,6-Anhydro-D-Galactose 4 Galactohydrolase [Pseudoalteromonas carrageenovora]
3WVJ_A	1.46e-06	102	238	61	167	ChainA, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43478	3.70e-37	42	299	46	296	Kappa-carrageenase OS=Pseudoalteromonas carrageenovora OX=227 GN=cgkA PE=1 SV=1
Q84C00	4.70e-06	102	238	90	196	Beta-glucanase OS=Acetivibrio thermocellus OX=1515 GN=licB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003674	0.727779	0.267251	0.000544	0.000356	0.000365

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000707_02036.