CAZyme Information: MGYG000000708_00310

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio
• CAZyme ID: MGYG000000708_00310
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443		48847.62	7.0039

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000708	1500808	MAG	Kazakhstan	Asia

• Gene Location: Start: 8118; End: 9449 Strand: +

Full Sequence      

MNLNPHLYAITAGEISGDTLGSGLMHAIKRLDPKAEFIGIGGPKMIAAGMRSYADINTLS
VMGISEVLSHIVPILRIRHRVGKLIAAARPCVMVGIDSPDFNLSLERKLQSLGIPAIHYV
SPSVWAWREGRLKKIKASCSEVLCLLKFEKDFYDQRGMKAAYVGHTLANAIALDNDQESA
RERIDLYRTSIEQIKGKVMGILPGSRSGVIEHMLPVYAQAARLVRKQMPDTVFISTVPTY
ELASKVKDLWLEYSPDLSLTVYVGSTRDVIASCDALLLTSGTVALETMLINRPFCVAYRV
SALTAAIGRRLLRISTYSLPNLIARTTLVREFIQEQCTPEALSHEMLQLLRSDNLVMKGQ
FRSVHEQMRMPSDSIAAQEVMRVIGRDLSKAEKADAGVADPVADTEDVEPQVTLPDPDDI
NEPDLKAEPVFDLHLGKDREGGK

Enzyme Prediction     

No EC number prediction in MGYG000000708_00310.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	9	368	5.9e-116	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.26e-149	9	386	5	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.15e-125	9	380	5	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
TIGR00215	lpxB	1.10e-103	1	381	1	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam02684	LpxB	6.64e-102	9	380	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	5.30e-44	3	333	225	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN89996.1	4.49e-102	5	380	6	375
ANQ22332.1	6.35e-102	5	384	4	377
QDF67758.1	9.57e-102	5	387	5	381
BCN24830.1	1.80e-101	5	384	4	377
ANQ17765.1	5.08e-101	5	384	4	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.62e-83	5	383	6	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.28e-83	5	383	6	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7MY02	1.15e-100	5	384	4	377	Lipid-A-disaccharide synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) OX=1224742 GN=lpxB PE=3 SV=1
B1KNT0	2.69e-100	8	389	9	384	Lipid-A-disaccharide synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=lpxB PE=3 SV=1
B8E7Q3	1.38e-99	2	396	3	391	Lipid-A-disaccharide synthase OS=Shewanella baltica (strain OS223) OX=407976 GN=lpxB PE=3 SV=1
Q8DBE8	1.89e-99	1	384	1	378	Lipid-A-disaccharide synthase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=lpxB PE=3 SV=1
Q7MIH2	1.89e-99	1	384	1	378	Lipid-A-disaccharide synthase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000708_00310.