CAZyme Information: MGYG000000710_00514

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110
• CAZyme ID: MGYG000000710_00514
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675		75878.36	4.5072

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000710	2205840	MAG	Kazakhstan	Asia

• Gene Location: Start: 13595; End: 15622 Strand: -

Full Sequence      

MKRILVSVLLLACLAAGLILPVLAEPTSLSLSAEGLALIQEFDSAATAQSVRSCESAVNA
YASQNKLELTQQQFDALVSMTSDIGTSTLGYRYGQTVAKGDYTDTALANAWCAWVKKNGS
FSETQLQRRIRELRVILYGDYSGENSELSFRYLIFKANGGELTDNTVLCYPVGEVYGELP
TANRSGKYFAGWFTAITDGTQIHSTSTVAENYTVYARWTNTKPGEPTEPTDPDEPEEPIP
VVRTSESGIQFIKDHEGFISKPVWDYQQYSVGYGSHCGPDDYPDGITEKEADILLRKMLR
DEFEPRVDALERKSGRTFSRQEYDALVSFSYNVGVSWMNGGYNIYRYVTTGNYSEMELVN
CFGSWINAGGESVDGLARRRIDEVNLYLNGVYSTGSTAYLYVKFRLNTDPSTVSGEKNYD
YTYYKPGTNFGTLPNASREGYNFLGWFEKASGGRRFTTDSRVPAYGLMTLYAHWEVADPE
PEPEPEPDFPFTDVPKDAWYYPAIFAVYQKGWTNGTSATTFEPEYCFARSMMVTMLYRIE
NQPSVSTDSPFTDVRQGRFYTAPVAWAFNVGLTKGNNDGTTFGPDEFMTREQLATFFYRY
AQMKGEDVSVSYDLSQHPDYGKMSNFSNAPMQWALSHGYLRLDSDGSLRPRESATRAESM
DFIARYMGLIEPYDY

Enzyme Prediction     

No EC number prediction in MGYG000000710_00514.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	245	383	5.3e-23	0.9854014598540146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	7.87e-26	248	388	1	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd16901	lyz_P1	8.98e-17	243	386	1	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	2.07e-13	243	392	6	152	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd00737	lyz_endolysin_autolysin	2.49e-08	48	119	51	118	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam09479	Flg_new	2.30e-07	424	473	16	65	Listeria-Bacteroides repeat domain (List_Bact_rpt). This model describes a conserved core region of about 43 residues, which occurs in at least two families of tandem repeats. These include 78-residue repeats which occur from 2 to 15 times in some proteins of Bacteroides forsythus ATCC 43037, and 70-residue repeats found in families of internalins of Listeria species. Single copies are found in proteins of Fibrobacter succinogenes, Geobacter sulfurreducens, and a few other bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCI60723.1	3.40e-32	488	671	390	571
BCK83697.1	3.07e-27	488	665	350	525
ARE59829.1	3.89e-27	468	667	767	961
QQR06511.1	3.89e-27	468	667	767	961
QNL43287.1	9.40e-27	491	666	381	554

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19424	4.96e-18	489	675	39	222	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
Q37896	7.65e-15	245	390	4	145	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
P07540	1.02e-10	242	390	1	145	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
P11187	1.02e-10	242	390	1	145	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
P62692	3.17e-09	242	396	1	145	Endolysin OS=Lactococcus phage c2 OX=31537 GN=L3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000290	0.999051	0.000169	0.000178	0.000153	0.000140

TMHMM  Annotations     

start	end
5	24