CAZyme Information: MGYG000000711_01559

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; CAG-238
• CAZyme ID: MGYG000000711_01559
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
162		17960.49	4.0099

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000711	1966926	MAG	Kazakhstan	Asia

• Gene Location: Start: 1656; End: 2144 Strand: -

Full Sequence      

MRLSEARTATDAVEADGVLTVSLLYHCENDETPLCMLERGIPFGQMMELRGVAEGDAAAV
QLRLDDLDFQMLSEQEGELRAAVTMEAVVLRDETAEDITPEEEAAPSPMAGAVIYMVQPG
DTLWKIAKRYRTTVEDILAVNEIENPDLIYPGQKLLIIKQIH

Enzyme Prediction     

No EC number prediction in MGYG000000711_01559.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	115	157	1.3e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	9.55e-20	113	157	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	1.05e-18	114	157	1	44	Lysin motif.
pfam01476	LysM	2.31e-17	115	157	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
TIGR02899	spore_safA	2.19e-14	117	157	1	42	spore coat assembly protein SafA. SafA (YrbB) (SafA) of Bacillus subtilis is a protein found at the interface of the spore cortex and spore coat, and is dependent on SpoVID for its localization. This model is based on the N-terminal LysM (lysin motif) domain (see pfamAM model pfam01476) of SafA and, from several other spore-forming species, the protein with the most similar N-terminal region. However, this set of proteins differs greatly in C-terminal of the LysM domaim; blocks of 12-residue and 13-residue repeats are found in the Bacillus cereus group, tandem LysM domains in Thermoanaerobacter tengcongensis MB4, etc. in which one of which is found in most examples of endospore-forming bacteria. [Cellular processes, Sporulation and germination]
COG1388	LysM	1.64e-12	82	159	38	112	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMJ42415.1	3.37e-46	1	161	355	519
ALX07044.1	3.23e-24	3	161	358	521
ANV74780.1	3.23e-24	3	161	358	521
QCU03902.1	2.09e-23	1	161	345	510
AEY64317.1	1.03e-22	3	160	358	520

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UZ2_A	3.28e-07	111	155	1	44	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32062	8.39e-07	114	155	3	45	SpoIVD-associated factor A OS=Bacillus subtilis (strain 168) OX=224308 GN=safA PE=1 SV=1
P37531	1.18e-06	114	157	3	46	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
Q6B4J5	3.20e-06	114	162	3	53	Spore coat assembly protein ExsA OS=Bacillus cereus OX=1396 GN=exsA PE=2 SV=1
Q5HGI5	3.85e-06	114	155	176	217	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain COL) OX=93062 GN=lytN PE=3 SV=1
Q6G9W6	3.85e-06	114	155	176	217	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=lytN PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000016	0.000016	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000711_01559.