CAZyme Information: MGYG000000712_00763

Basic Information

• Species: Fusobacterium_B sp900541465
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_B; Fusobacterium_B sp900541465
• CAZyme ID: MGYG000000712_00763
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000000712_32|CGC1	40702.93	9.557

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000712	2138816	MAG	Kazakhstan	Asia

• Gene Location: Start: 15786; End: 16859 Strand: -

Full Sequence      

MKIFVSAGEVSGDLHLSYLVKNILEIDSSVKFYGAAGDLSRAAGVEIVQDIKELAVMGFV
EGLKKYSFLKKRAKEYLNFIKENKIDKVILVDYGGFNLAFLKLLKSKAPEVEIYFYIPPK
LWVWGEKRINTLKLADHILVIFPWEVEFYKKHGIKAVYYGNPFSEKYHLIENRGDKILLL
PGSRKQEIQSLMPVMLEVVKARPDKTFVLKLHSAKPFEWVENDLLKYPNLVIETNKTLEE
IVKECETAIAASGTVTLELALMGIPAIVLYKTSAVNAFIARHILKIGLVSLPNLTLNKEV
YPELLQEKCTSRDVLFYLNVLKSKEDKINKDIKEIREKLSGENVVKNYGKYILKGQN

Enzyme Prediction     

No EC number prediction in MGYG000000712_00763.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	337	9.7e-98	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	8.84e-105	1	354	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	1.99e-87	1	342	2	362	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	2.66e-70	3	330	1	347	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	4.40e-59	1	346	2	342	lipid-A-disaccharide synthase.
PRK01021	lpxB	1.94e-36	4	327	230	575	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH39859.1	5.94e-175	1	356	1	356
AVQ31390.1	5.94e-175	1	356	1	356
BBA50470.1	6.54e-172	1	356	1	356
SQJ09670.1	1.32e-171	1	356	1	356
AVQ26961.1	1.32e-171	1	356	1	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.07e-30	1	309	7	332	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	5.42e-30	1	309	7	332	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	7.32e-55	2	314	8	335	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q3JAC1	6.51e-53	5	325	10	346	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
Q74AT9	9.12e-52	2	311	8	332	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B3E4H8	7.26e-50	2	314	8	335	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q6ALW0	2.15e-49	2	310	11	338	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000712_00763.