CAZyme Information: MGYG000000712_01775

Basic Information

• Species: Fusobacterium_B sp900541465
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_B; Fusobacterium_B sp900541465
• CAZyme ID: MGYG000000712_01775
• CAZy Family: PL8
• CAZyme Description: Hyaluronate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654		77165.25	5.1753

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000712	2138816	MAG	Kazakhstan	Asia

• Gene Location: Start: 2318; End: 4282 Strand: +

Full Sequence      

MIEKITVLDRRREYLAGTGFTPPDVVTFLNQKVRQILIEDDNIVFENYEKVQNIEKVKKF
YENTFILAKAYMSDGTEYYSDMDILKLIEERLKYGNEYFYNKEIGNYGDIYGTEIEIPLM
ITDILILTENKIKEKVLKPVLETLEYFQPDPRYSAHHSSEFGFSKGADLAEAIKVFFLKG
IISEDEEKIILALNTLSDVWEYKDDSFSTDRDGFYRDGSFISRSAADAGNEGEKIIHNAA
EIFYLVKGTKYEKYIKGLTNFYEILFKSFEPFFFNGSFSDVAVSRKFSSYETGHRILNSM
LLAGLSAPKEYQEKIWKTVKREIEKNKFYKYFENEKSPFFRSKMNELLSRDLETEEYKDQ
VIVFNNMDRVIKRNKNYSVGISMHSSKTGNYENVNGDNRKNWFTGDGAYFLYDEDYEQYE
NYWENIDPYYIPGTTEIKMDMENVDAERNFRTKFAERNMAGALKWHYYGAAGMDFVNWNE
KLTSRKSWFFVSWGVIFAESNITGEGEVYTTILNRKFKDIPLIKADNREITENEIKIKTE
NLEIDGRTYIFYGRTEINIKIEKRGKYYFVKVWKEHGENPVNSSLVWAVVMKNNAVICDL
REKFTITITEDKHILKGEKCNYAVNWKAEEETQPFCVIYRKDDNRESRMYIKNY

Enzyme Prediction     

No EC number prediction in MGYG000000712_01775.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	363	590	7.6e-46	0.9652509652509652

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	1.81e-98	6	645	4	685	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	7.23e-50	363	590	3	248	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	4.66e-34	61	321	62	323	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ18397.1	1.75e-155	1	653	5	662
QNM15126.1	5.96e-152	1	652	1	657
ACZ00610.1	1.84e-82	7	618	4	618
AVL42978.1	1.84e-82	7	618	4	618
AEE16979.1	5.92e-78	6	587	8	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F1S_A	4.56e-51	30	586	117	703	CrystalStructure Of Streptococcus Agalactiae Hyaluronate Lyase At 2.1 Angstrom Resolution. [Streptococcus agalactiae],1I8Q_A Crystal Structure Of Streptococcus Agalactiae Hyaluronate Lyase Complexed With Enzyme Product, Unsaturated Disaccharide Hyaluronan [Streptococcus agalactiae],1LXM_A Crystal Structure of Streptococcus agalactiae Hyaluronate Lyase Complexed with Hexasaccharide Unit of Hyaluronan [Streptococcus agalactiae]
1N7O_A	4.38e-48	45	518	60	533	ChainA, hyaluronidase [Streptococcus pneumoniae]
1OJM_A	4.73e-48	45	518	60	533	SpecificityAnd Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex With Unsulphated Chondroitin Disaccharide [Streptococcus pneumoniae]
1C82_A	4.83e-48	45	518	62	535	MechanismOf Hyaluronan Binding And Degradation: Structure Of Streptococcus Pneumoniae Hyaluronate Lyase In Complex With Hyaluronic Acid Disaccharide At 1.7 A Resolution [Streptococcus pneumoniae],1EGU_A Crystal Structure Of Streptococcus Pneumoniae Hyaluronate Lyase At 1.56 A Resolution [Streptococcus pneumoniae],1F9G_A Crystal Structure Of Streptococcus Pneumoniae Hyaluronate Lyase Cocrystallized With Ascorbic Acid [Streptococcus pneumoniae],1OJP_A Specificity And Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex With 6-sulphated Chondroitin Disaccharide [Streptococcus pneumoniae],1W3Y_A Crystal structure of S. pneumoniae hyaluronate lyase in complex with palmitoyl-vitamin C [Streptococcus pneumoniae],2BRP_A Crystal structure of S. pneumoniae hyaluronate lyase in complex with W249b [Streptococcus pneumoniae],2BRV_X Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 70percent saturated malonate. [Streptococcus pneumoniae],2BRW_A Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 30percent PEGMME. [Streptococcus pneumoniae],2BRW_B Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 30percent PEGMME. [Streptococcus pneumoniae]
1LOH_A	5.96e-48	45	518	60	533	ChainA, Hyaluronate Lyase [Streptococcus pneumoniae],1LXK_A Chain A, Hyaluronate Lyase [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q53591	4.54e-50	31	586	289	873	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
Q54873	5.26e-46	45	518	346	819	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2
Q59801	1.42e-35	45	644	118	759	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
Q9AQS0	3.23e-35	55	516	91	541	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
P0CZ01	1.25e-17	67	516	114	569	Hyaluronate lyase OS=Cutibacterium acnes (strain DSM 16379 / KPA171202) OX=267747 GN=PPA0380 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000712_01775.