CAZyme Information: MGYG000000714_00241

Basic Information

• Species: CAG-451 sp000438295
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-451; CAG-451 sp000438295
• CAZyme ID: MGYG000000714_00241
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A/1B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
946		104175.01	8.703

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000714	1374960	MAG	Kazakhstan	Asia

• Gene Location: Start: 67228; End: 70068 Strand: +

Full Sequence      

MKKKTTQKSNSNLTLILLGCFLVLMIISYFIIGWLLTVFLGVGILIIVGLARLLDKVKNK
PKQKKILNIIIIVILSLGILVMLLGILFLAYVVIKAPKFDVNQLNEKEPSILYDIDGNEF
ERLGTEMREKVTYDELPEVLVDAIVATEDSRFFQHNGFDAPRFLKASLGQAVGHSDAGGA
STLSMQVIKNSFTSADDHGIKGIIRKFTDIYLAVFKLEKNYTKEQIIEFYVNNHNLGGNI
YGVKQAALAYFNKDIGDLNLAEASVLAGMFKAPNLYKPTNTDNIKSVTRRRNTVLYLMER
HGYITSDERKMASDISIESLVDYNVSAQSGLSKYQGYIDTVVDECIAKYKADPYTVSMKV
YTNLDRSKQDGVDKVMNGETYAWANDTIQSGVSVLDSATGKILAIGAGRNKKGAKELNLA
TSDEIKRQPGSTAKPLFDYGPLIEYNNASTYGYNDNGNYKMFVDEPYSYTNGKSINNWDG
TFMGAITMRKALSLSRNIPALKAFQQVDNKKIIEFVQNLGIEPEIENGKIHEAHSLGAFT
GVNSLQMAAAYAAFSNGGYYNEPYSVSKVVFRDTGEEKKHEGTKKQAMSDATAYMITSIL
DDVTLIGTGNMDKIAMKTGTTNFDQKTRQTLGMSDDAIRDSWVIGYTTKTVIGMWYGYKD
TSKNLVNQGLYCHNLRCTIQRDKLFTAIANSVFEKNKEEFKMPNSVVKLGVVVGSNPARI
AGAGYSGAVTYEYFKKGSEPTNTQTEESNLSAPTNLKATYNSSNNSVSLSWNAVTPPSNS
SYGTFGYNVYFNNTLLGFTSNTSFTVTNQNNPYGTYKVIATYKSYDGVKSNAATYELKKV
STTLKVTYKTISTTSYNISDISNYVTVTENGNDITSKTSNWKLSSITGPGGVSLSTSTLS
TPGTYTLKYKFSYDGETKETGNITVTITGSTNPTEPTAPGEAETIE

Enzyme Prediction     

No EC number prediction in MGYG000000714_00241.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	117	298	1.3e-52	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	2.60e-141	81	749	27	658	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	8.20e-90	84	749	20	773	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.35e-62	116	299	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	4.81e-60	83	657	7	534	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	1.90e-38	100	569	35	595	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APH04640.1	3.60e-148	70	772	35	714
ASS91702.1	1.15e-145	70	772	31	708
AXI39978.1	1.18e-145	70	772	31	708
BBU39970.1	2.26e-145	70	772	31	708
AWI12666.1	4.90e-145	58	837	17	776

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	2.79e-77	104	706	2	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	1.32e-75	95	706	2	611	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	1.51e-53	216	663	2	437	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	6.70e-49	216	663	2	437	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
2ZC5_B	3.05e-48	332	719	3	390	ChainB, Penicillin-binding protein 1A [unidentified],2ZC5_D Chain D, Penicillin-binding protein 1A [unidentified],2ZC6_B Chain B, Penicillin-binding protein 1A [unidentified],2ZC6_D Chain D, Penicillin-binding protein 1A [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	2.83e-123	85	772	52	728	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q04707	4.89e-87	59	719	2	653	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q00573	1.38e-86	59	671	2	613	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q8DR59	3.45e-86	59	719	2	653	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
P38050	1.24e-66	60	726	3	630	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000013	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	32
36	54
67	89