CAZyme Information: MGYG000000715_00090

Basic Information

• Species: CAG-110 sp900544705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900544705
• CAZyme ID: MGYG000000715_00090
• CAZy Family: GH125
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602	MGYG000000715_1|CGC1	68150.17	5.0429

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000715	2198914	MAG	Kazakhstan	Asia

• Gene Location: Start: 97724; End: 99532 Strand: -

Full Sequence      

MNYQVTGNEYIALPTLREADAALESLSFLHMGAKGMLELHGTQERPLLAPFVQREGSETP
LTGLRWERLHSWIPRFMTELCGLALEGVLLTPIDERGFGWRLRATNREAEAEITLGLRGT
WAKTLHSVNESKPVAGEKHLYPSGWNHCYVMDLRPGLSLFAFAPIYTEQPEHCPIRSQFE
RADEEIRYHIVQRQTLAPGETLELTVWFGLGFEEVSAATSAKELLRQGFAQELERTERWL
SERERTVNDARLDEILNTNLFFSYFFGAGRTLDTEEFVLVTSRSPRYYVSAAYWDRDSLL
WSFPAILLADPETARQMLHYVFTRQIRNVGLHSRFIDGTLLEPGFELDELLAPVIALFRY
VQKTGDRAILEKPWLREGIAHILARLQSKRSADAALYETFLQPTDDVRRYPYLTYDNVLV
WYSLHALAALFPEHAALAETAESVRSAIYEHCVREKDGEMIFAWSVDLQGGWDVYDEPPG
SLLLLPHFGFCGQDDPIWRHTAEVIRAKEYPYSFAGCPIAEIGCPHAPHPWVLSIANSLL
SGSRDSAKTHLLRCKLDNGIACESVDEFTGESATGEAFATCAGFLAYAIDTAFTGRRKED
GS

Enzyme Prediction     

No EC number prediction in MGYG000000715_00090.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	395	582	6.8e-18	0.5024875621890548

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3538	COG3538	4.17e-20	292	579	60	409	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
pfam06824	Glyco_hydro_125	9.64e-15	292	566	41	392	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
COG3387	SGA1	0.003	294	505	286	507	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
COG3459	COG3459	0.003	190	371	514	692	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR05501.1	5.64e-238	3	600	5	599
ANU41635.1	5.64e-238	3	600	5	599
QIA31705.1	1.61e-237	3	600	5	599
QKN24824.1	4.95e-233	7	589	4	582
ARP51233.1	4.95e-233	7	589	4	582

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	1.80e-13	292	546	105	418	Crystalstructure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	2.91e-13	292	546	87	400	Crystalstructure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3ON6_A	1.07e-10	292	546	85	398	Crystalstructure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000715_00090.