CAZyme Information: MGYG000000715_01913

Basic Information

• Species: CAG-110 sp900544705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900544705
• CAZyme ID: MGYG000000715_01913
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
743	MGYG000000715_24|CGC1	82039.14	7.6562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000715	2198914	MAG	Kazakhstan	Asia

• Gene Location: Start: 3341; End: 5572 Strand: -

Full Sequence      

MKIIHMISGGDVGGAKTHVLSLLAGLNKTEDVHLICFTEGAFAQEARRLGIPTTVLCDGS
LLSVRRRILAMIRHDGYQIIHCHGARANLMGMLLRRRAGIPVISTIHSDYRLDYMGRPLA
ALGYGTINKIALRHLDAWIGVSDGMSQLMISRGFDPQRIFTLYNGIDFSVRSDYPPREAY
LRSLGVSLEPDSVVFGIATRISPLKDMATLLRAFAAALRTHPHIRLVIAGDGPQEAEMKA
LAAKLCPAGTVCFAGWIREINQFYHALDVNLLTSLSETFPYALTEGARMSCATISTDVGG
IPYLIDDGVNGLLFHPKDADKLAEHIGYFASHPQAREEMGKALYEKAKRMFSFDNMVHTQ
EKYYEVIVRRAKRPPLLRDGAVICGAYGLGNGGDNAILEAIVAQLKNIDPDLPICVLSRD
PEETRLSAHVSAVYSFRFIKIFRLLRSSDLFLSGGGTLLQDATSTRSLLYYLLMIRLAHD
TGNRVMLYGCGAGPILRERNRRRTARVLDRCADVITVRDDYSADFLQELGVTVPRIHVTA
DPALLSKPLPEDAARSYLLRCGIDATKKYAMLALRSWDGVMAKLPAFAAAAEYLYCDCGL
IPVLYSMEQKNDLPIAQAVAARLRCPHLVLQAGDNAGEILTLVRRMSLVISMRLHVLVFA
SGQGVPLVGIVYDPKVSAFLDHLGQDLYLPLAETNAASLCDLIDAALAERHFERENIRHL
RHLANKNEEVLRGLLDEDELPDL

Enzyme Prediction     

No EC number prediction in MGYG000000715_01913.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	194	341	7.7e-33	0.93125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03609	S_layer_CsaB	2.37e-63	381	686	1	291	polysaccharide pyruvyl transferase CsaB. The CsaB protein (cell surface anchoring B) of Bacillus anthracis adds a pyruvoyl group to peptidoglycan-associated polysaccharide. This addition is required for proteins with an S-layer homology domain (pfam00395) to bind. Within the larger group of proteins described by pfam04230, this model represents a distinct clade that nearly exactly follows the phylogenetic distribution of the S-layer homology domain (pfam00395). [Cell envelope, Surface structures, Protein fate, Protein and peptide secretion and trafficking]
cd03801	GT4_PimA-like	2.11e-59	3	367	4	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03808	GT4_CapM-like	1.22e-56	2	357	1	354	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03807	GT4_WbnK-like	3.63e-56	2	365	1	362	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
cd03811	GT4_GT28_WabH-like	3.39e-46	2	353	1	348	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU41018.1	3.80e-268	1	736	1	739
QIA31360.1	3.80e-268	1	736	1	739
QQR06197.1	3.80e-268	1	736	1	739
QCI58359.1	5.89e-260	1	735	1	739
BCK82856.1	4.06e-252	1	735	1	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TVP_A	2.80e-26	13	366	30	395	Structureof Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155],6TVP_B Structure of Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155]
5D00_A	1.51e-14	62	364	75	372	Crystalstructure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D00_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D01_A Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168],5D01_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168]
4XSO_A	3.80e-13	1	326	7	343	ChainA, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSO_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSP_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSP_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSR_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSR_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSU_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSU_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418]
5I45_A	7.58e-13	190	372	27	217	1.35Angstrom Crystal Structure of C-terminal Domain of Glycosyl Transferase Group 1 Family Protein (LpcC) from Francisella tularensis. [Francisella tularensis subsp. tularensis SCHU S4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R2E2	1.25e-25	13	366	16	381	Alpha-maltose-1-phosphate synthase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glgM PE=1 SV=1
D2Q1C4	1.08e-20	10	348	30	399	D-inositol 3-phosphate glycosyltransferase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) OX=479435 GN=mshA PE=3 SV=1
C7MSY6	5.09e-18	77	349	116	401	D-inositol 3-phosphate glycosyltransferase OS=Saccharomonospora viridis (strain ATCC 15386 / DSM 43017 / JCM 3036 / NBRC 12207 / P101) OX=471857 GN=mshA PE=3 SV=1
Q47KS6	1.65e-17	26	342	93	399	D-inositol 3-phosphate glycosyltransferase OS=Thermobifida fusca (strain YX) OX=269800 GN=mshA PE=3 SV=1
A4FQ08	6.91e-17	73	339	110	391	D-inositol 3-phosphate glycosyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000715_01913.