CAZyme Information: MGYG000000716_01030

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000000716_01030
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290		32675.92	4.6335

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000716	2039168	MAG	Kazakhstan	Asia

• Gene Location: Start: 25054; End: 25926 Strand: +

Full Sequence      

MRYALPEPAPLVSIVIPTKDHVETLDACVMSIAQKATYANYEIVLVENNSEAPETFAYYE
TLPECVAAASECKGIARVAYWPGEFNYSQIINFGAEHAKGDYLLLLNNDTEVIVPGFIEE
LMGYLQRPDAGVVGAKLYFSDYLVQHAGILVGVRGALAHANQDFSAKREGYLARAVRPGN
FSAVTGACQMVRRDVFERVGGYNEEFAVGFNDADFCLRVWVAGYRTIFSPYAVLYHYEFT
SRGREEANEEKLRRWKREQALFMQRWPEFFLDGDPWLGSYLSSESEFGAL

Enzyme Prediction     

No EC number prediction in MGYG000000716_01030.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	12	241	1.1e-21	0.9217391304347826

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	3.45e-43	14	238	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.15e-31	10	263	3	248	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam13641	Glyco_tranf_2_3	1.31e-20	10	238	2	213	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam00535	Glycos_transf_2	1.93e-20	13	196	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	1.87e-19	10	233	54	261	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP53737.1	1.36e-188	1	287	539	825
QIA33434.1	8.80e-187	1	290	539	828
AZH69434.1	5.69e-185	1	290	539	828
QOY61397.1	1.58e-115	1	290	515	801
CBL21587.1	3.96e-90	7	286	537	808

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.77e-55	7	266	622	874	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.57e-39	10	242	574	798	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P9WMY2	9.86e-08	101	248	93	247	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	9.86e-08	101	248	93	247	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
P46370	8.60e-06	12	236	132	329	Uncharacterized 55.3 kDa protein in thcA 5'region OS=Rhodococcus erythropolis OX=1833 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000088	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000716_01030.