CAZyme Information: MGYG000000719_00715

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; HGM12650
• CAZyme ID: MGYG000000719_00715
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342		36912.92	5.2549

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000719	1825952	MAG	Kazakhstan	Asia

• Gene Location: Start: 15854; End: 16882 Strand: +

Full Sequence      

MNSRAYQILGSMTLDEKIGQLFIVRCPREGATEAVKKYHLGGFTLYAVDFGDDKTGQGKS
PEEVRHDIDGYQAASELPMFIAVDEEGGNVVRASKFQSLRETPFESPAEVFSRGGLEALA
ADTKAKCRFLRSLGVNLNYAPVCDLSFDRTNYIYHRTFGQDAKTSADCAAAVVSMMKRMR
MGCSLKHFPGYGDNVDTHTGIARDAKRTREEFGSSDYLPFLGGIGAGAGMVMVAHIIVDC
MDGERPASLSPEVHRILREDMGFSGVIVTDSLDMGGITQFTGGSEAAVAALLAGNDLLCC
SSYGSQIPAVRAAIADGTLTERRIDESVLRILDYKLSLGIIG

Enzyme Prediction     

No EC number prediction in MGYG000000719_00715.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	74	299	5.7e-44	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	2.74e-54	13	332	1	314	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	2.60e-52	12	340	1	317	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	7.44e-32	60	299	38	280	beta-hexosaminidase; Provisional
PRK15098	PRK15098	6.14e-17	7	340	40	358	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02560.1	2.33e-121	1	342	85	419
BCI61427.1	1.11e-119	8	341	156	482
QHQ63470.1	5.13e-113	3	341	83	414
ABX42693.1	1.04e-110	5	341	79	408
QWT55932.1	6.73e-108	8	341	111	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BMX_A	1.49e-34	5	340	35	398	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	6.18e-34	5	340	9	372	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	7.27e-34	5	340	39	402	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	7.36e-32	11	335	10	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	5.34e-30	14	335	9	337	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	8.17e-34	5	340	35	398	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	6.92e-32	32	338	56	383	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q7WUL3	2.20e-27	9	340	23	354	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
B4SRK3	2.29e-24	72	298	48	275	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
B2FPW9	3.16e-24	72	298	48	275	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000719_00715.