CAZyme Information: MGYG000000719_01360

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; HGM12650
• CAZyme ID: MGYG000000719_01360
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		61943.97	9.5378

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000719	1825952	MAG	Kazakhstan	Asia

• Gene Location: Start: 22067; End: 23716 Strand: +

Full Sequence      

MKKKPTLYIIIIAAWVCCLALLGYSFFAVLGGLEGFSPVRRGFIIALLATNTIVLAVLWF
GSIKDLTFSLAYAFMGKRMLSRYKDIKEITVDPKNAPRVLLLYCTCNDFNAAALSTCRKQ
KYPNFKTVILDDSRESSYIEEIDRYVAQNKNVEVVRRADRVGYKAGNINNYLKGRTDYDY
FVILDSDEIIPPDFITKALKYFVYNENCGAVQAKHEATKGGNLFQRLMGLCVGSNGTTVQ
VVKNFYGANALIGHGMMITRECYEKTGGFPLVVAEDISFAVDIKNAGLDIIYAPDILCYE
EFPVNYVSLKKRQCKWTQGNLEYMRKYNRDIDRSKMSWFEKLDIKLSHYSLPIVPVLSFL
LVICTLTLGFLGYTVINYSLIIYAVMIVFLCSPMIPDLIVYRRSRNFFLLIPYFIINIAT
YASLAPMMLKTVFLGAFGKKAVFTVTPKRAENFTAEEILRYSWDSVLFAAAIGVLSIFAC
GSVLPVIFITVGCALAPFIIALSNIRINEKVTTAKIPVRRHIPLTGETEKVFTVTAKRRA
KNRPPVSER

Enzyme Prediction     

No EC number prediction in MGYG000000719_01360.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	119	305	4.6e-23	0.8260869565217391

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	4.01e-28	48	508	4	427	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06421	CESA_CelA_like	1.19e-27	97	322	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
cd06437	CESA_CaSu_A2	5.64e-24	113	319	19	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
pfam13641	Glyco_tranf_2_3	1.26e-17	119	303	26	214	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam13632	Glyco_trans_2_3	1.29e-15	180	381	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDL20008.1	6.49e-164	1	510	1	513
QDL19322.1	6.49e-164	1	510	1	513
QIN44161.1	6.49e-164	1	510	1	513
QIN44840.1	6.49e-164	1	510	1	513
QIN42784.1	6.49e-164	1	510	1	513

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZQB9	1.60e-17	97	361	241	520	Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=CSLC12 PE=1 SV=1
Q7PC69	3.28e-14	97	361	261	540	Probable xyloglucan glycosyltransferase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC3 PE=2 SV=1
Q6Z2T9	4.56e-14	33	342	76	400	Probable glucomannan 4-beta-mannosyltransferase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA6 PE=2 SV=2
Q9FNI7	2.84e-12	122	341	124	354	Glucomannan 4-beta-mannosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=CSLA2 PE=1 SV=1
B8E7D2	2.58e-11	156	344	206	404	Glucans biosynthesis glucosyltransferase H OS=Shewanella baltica (strain OS223) OX=407976 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
44	63
351	373
378	400
407	429
468	502