CAZyme Information: MGYG000000720_00029

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000000720_00029
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
933		105072.51	5.0768

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000720	3759035	MAG	Kazakhstan	Asia

• Gene Location: Start: 26127; End: 28928 Strand: -

Full Sequence      

MDISASWIWSDNSDGRNYNLCSVFRREFRLEKLPESAKLLITADSYYRLKVNGQWLGDGP
ARAWPEHFQYDIYDLNGCLRHGVNQIEATVRYYGCGTFHQIPQRAGLLAQLELVNPDQRI
VTDESWFAAKMPQWVENTVKASIQQPPLELFDASRVTGMEWKPATVICGAEAGPWRGLHE
RDCKQLSRRESLFRRFCGGHRVQPEPLTLAFPVQQLLFPGDTTVNNGNLLPFLAAFIVES
PQSQIVHLGLENMRVSVNGRSDLNGEVSLNAGNNLFVAAAAKLWGHQPICEVSFPADAGV
TLRNFYDSSDKIAMFEFPEIARLAEDIPFPWADGIGKERREQFNRISAEALAIRTVEEFR
NRFPSPRMLDRSELAADPNQAFLHRKPLPLEPGDVENPNALIYNDDCCTVVNPVPGCDIE
LCYDLGEQDVGFWNFALFAEAGTILDVSAVEYILPDGRLQHTGAIYRNFMRYICREGYNR
YSSMRRRSGRYLFLTIRNATKPVRIQLARLIESTYPVIPEGEFHCSDPRLDRIYEISART
LKLCMEDTFTDCPLYEQTLWVGDARNESLFAMSTYGAYDLVRRCIRLAGQSLERLPLVGC
QVPSGWSCLIPVWSFMWGISVQDYCAETGDLAFGREVWPMVVRNLDGAQSMIDPATGLLS
GEHWNLFDWSKTESDHPILLYNSMFLIGALNAAIELGEALEEPVDSFRERREALKSAVNA
MWDSRKLAWPDSIHADGTVSEDASVHTSMLALLYDIASPEHIAAARANTVTPRPELIKVG
SPFASLYLYETLEKIGMENEILKAIRRDYLPMLELGSTTVWETYPDALNVGEFPTRSHCH
GWSAAPLYFLPRLLLGILPAAPGAKKFRISPRITGLEYAAGARPTVHGRVETAWKKQGDK
LFITATAPAGVELEYLCNDTHADFEVIFNGESM

Enzyme Prediction     

No EC number prediction in MGYG000000720_00029.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	421	914	1.7e-92	0.9761904761904762
CBM67	5	175	2.1e-32	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.44e-37	521	852	4	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.64e-11	32	132	1	116	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	5.96e-08	856	914	1	60	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	3.59e-05	617	761	89	251	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam04685	DUF608	0.001	623	737	111	233	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44894.1	0.0	1	931	1	931
AMV40823.1	4.85e-258	3	930	35	973
AQQ70857.1	2.99e-236	3	930	1	939
AKJ65556.1	8.22e-233	5	926	8	939
QHI68391.1	3.64e-230	1	933	2	948

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.03e-138	4	913	7	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.86e-29	485	850	169	538	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
3CIH_A	1.05e-28	479	890	263	672	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	4.89e-10	412	932	375	920	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000720_00029.