CAZyme Information: MGYG000000720_00110

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000000720_00110
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	MGYG000000720_1|CGC4	43153.6	9.0589

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000720	3759035	MAG	Kazakhstan	Asia

• Gene Location: Start: 125587; End: 126744 Strand: +

Full Sequence      

MKRSIWILAGEASGDVYGAKLARELRRIAAERGDELTISGMGGPKMIAAGIDIRVDSTEL
GVVGVIEVLKHIFTFIGIFFRLVKQARRERPGAVVLIDYPGFNLLFALMMYASRIPVIWY
VCPHLWVWGKWRLPVLAKICTKMLVIFPFETEVFAPTRLETEFVGHPLIDIVEERRKPEI
VRDPESFLLLPGSRTMEINFLLYPMLDTITELSKRHPELKFHLAAPREKIARLCREKLAD
YRRRHPETPEVAVSCGDTSDWQQRAGTGLAASGTVTVESAIAGLPLVVGYKLNWVTILLA
ALVVKLYRGYFTMVNIIANREVFQEFLQHHFRASELVPAVEAILPGGSRRAEVEAGMLEV
KQLLSPNSSSAGRQAAEACYSVLAR

Enzyme Prediction     

No EC number prediction in MGYG000000720_00110.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	364	5.7e-93	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	6.21e-96	1	378	1	370	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.90e-95	1	378	1	374	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.36e-74	5	378	1	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.36e-61	4	378	7	381	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	3.66e-33	4	355	228	581	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45461.1	1.74e-249	1	383	10	392
QSH40861.1	1.36e-167	3	380	6	383
QHI67954.1	3.91e-64	1	368	1	362
QUE51553.1	6.36e-63	1	357	1	350
ABF41536.1	1.57e-61	5	385	4	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.39e-31	4	375	8	376	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.65e-31	4	375	8	376	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1INL4	3.15e-62	5	385	4	380	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
Q02AZ6	5.37e-55	5	375	4	366	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1
Q2IL69	1.03e-50	5	364	11	365	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B8JE78	1.53e-49	5	364	11	365	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	2.15e-49	5	364	11	365	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000720_00110.