CAZyme Information: MGYG000000720_00641

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000000720_00641
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
964		105813.94	6.4237

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000720	3759035	MAG	Kazakhstan	Asia

• Gene Location: Start: 72037; End: 74931 Strand: +

Full Sequence      

MKHLWIPAALAALCASAGAADRLIVEDFSDVGTWRTNGVRNVTPGKWFGADLCLGGTPDA
SRDDGYAGKLLFHFADPAQRSALDFVRAKAGQPEVFADGVELDVDPRGVTGRFSFTLEDA
GGKQFRTGSAPFSGQGWRRCRAEVGEAAKTHTGPFKLVKVHFEAEGISGSGYILVDDIAM
TGDVSRRRRISIRPVLSSLATEPGKPGKTSYRFRNASAGKVEGTVRCRLLDWKDRTVMDR
TFPLAVPPFGSAVLDVPLPALEIGCYPMTIEFTSGKVRSDYTDWIAAFHPNNGRKNSHPM
WFGIQDTSIWNCEAENALHYEWMKMAGFDIERLGITGNRLDNGEVTNFEGYEKILRSNRD
AGMIACASYTEGVPAYTQEKELWRGLPTKPEAFRGHMDKVFRCLRNYPNVQYFEFWNEPD
LGFLIGTLDGYLDALKIVRAAQKENAPEIRIATGGVTIIHPKEKKNFSRDMYSRGKGLYD
VACFHAHGSLLNYVERQELLEKWLAEAGVDLPVCNTETGDRSGYTVDTIKRHAVTLVKKI
VYAKSRHTEFYTWFTLQDYWDMDFEADDSFGLVTSDNRPKPSFVAYNELIRRLGNTGQGE
LLSGTGALEIYRFKDEKGNREVLALWPKVAGTRQLLSLEGRGEVTVAGIFGKESRLNAPF
VTIPVEDPVYVSYPLGGFRLAAAVAEQTQVTGARAGSEVSVPLALRNPFSVPARVVVEGN
APVELAAGEKRVLSIPVAVPADAVNGIFSLDREVKLEAGSGKLSLTVPLAVNVGYPVAAG
RTAAAHIVLDTLDRVHELTFDPAIPRWKGAADLSCDLAMTRENGALRIVARVTDDRHVMN
SKPEEGWRDDSIQIGFQNLDGAFTEITLSGEDGGGAAYASVVPAPASAGEWKVPVSVKRT
GNVTLYEVSLPLEKLGIADRSGTLFRFSFLVNENDGQGRVRWIEWMGGIGRSKNPDEFGW
GVLL

Enzyme Prediction     

No EC number prediction in MGYG000000720_00641.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	1.81e-49	787	963	3	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	4.00e-12	807	961	30	181	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	3.81e-05	798	945	3	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam01229	Glyco_hydro_39	7.41e-04	320	586	48	344	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46271.1	0.0	1	964	1	966
AHF91202.1	3.64e-160	15	963	25	1041
AHF91198.1	3.68e-155	15	963	25	1042
AHF92778.1	6.88e-152	23	960	214	1174
AVM46501.1	3.74e-146	22	960	195	1150

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000538	0.998517	0.000268	0.000235	0.000209	0.000199

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000720_00641.