CAZyme Information: MGYG000000720_01138

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000000720_01138
• CAZy Family: GH51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515		57401.42	5.6324

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000720	3759035	MAG	Kazakhstan	Asia

• Gene Location: Start: 49128; End: 50675 Strand: -

Full Sequence      

MTRTEFCALISMLLGVAPLLGPAAEIGAGHEYDNIILEEPIHRSEKELPAEFRLLPEKTI
RDYDAKMFGLSYDFAAQDGISMAAEVPGKPYPEILPDFTDAARGVPLPLNRLWLLKDNWK
FASGPLAERVKHKQASWAPERIQVTGPVETIRSILAVDPEAQFDIMVSVGDAECARQARE
IAEFLTGDASTEWGRKRIEWGLPDPVKVAIWELGNETDWSSQKLTADKYVQTCKEVMAAI
RSVVPDAKFAPHAATAPWHETQNKHWKEWHRKLLAELADEIDYFAFHPYYHGYPISVIDN
YLGVIRDDIASSSNPGIRIFISEHGLWPGGEPGRWENSWYKTHALQGCLAVSEWFNRMLA
RPEVAAMTMHACSSGPWGMFYPDPYSRKVYATGLAELFKFYKLIPFGGKVIGQELRGEGT
AFDGKLSLSAVAVEQDGKRYVVLTNRLPDTDRELSLDLAGGTVEHVYTLTADSVSEVNTA
VDKPIAIHYRKGTAEDAKTIRLPAGSVTLLVCRAK

Enzyme Prediction     

No EC number prediction in MGYG000000720_01138.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	118	512	1.5e-32	0.6031746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3534	AbfA	2.78e-13	118	515	78	501	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
smart00813	Alpha-L-AF_C	6.70e-05	322	506	1	189	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
cd21510	agarase_cat	0.005	211	403	102	319	alpha-beta barrel catalytic domain of agarase, such as GH86-like endo-acting agarases identified in non-marine organisms. Typically, agarases (E.C. 3.2.1.81) are found in ocean-dwelling bacteria since agarose is a principle component of red algae cell wall polysaccharides. Agarose is a linear polymer of alternating D-galactose and 3,6-anhydro-L-galactopyranose. Endo-acting agarases, such as glycoside hydrolase 16 (GH16) and GH86 hydrolyze internal beta-1,4 linkages. GH86-like endo-acting agarase of this protein family has been identified in the human intestinal bacterium Bacteroides uniformis. This acquired metabolic pathway, as demonstrated by the prevalence of agar-specific genetic cluster called polysaccharide utilization loci (PULs), varies considerably between human populations, being much more prevalent in a Japanese sample than in North America, European, or Chinese samples. Agarase activity was also identified in the non-marine bacterium Cellvibrio sp.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44875.1	4.83e-125	20	510	205	701
SDT99044.1	5.21e-84	3	515	10	540
QDU72262.1	1.59e-71	11	490	13	516
QDU70476.1	2.40e-67	29	510	41	540
AHF91282.1	3.74e-26	119	404	122	418

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y2W_A	8.71e-09	118	347	120	363	Elucidationof the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_B Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_C Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_D Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_E Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum],2Y2W_F Elucidation of the substrate specificity and protein structure of AbfB, a family 51 alpha-L-arabinofuranosidase from Bifidobacterium longum. [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q841V6	4.72e-08	118	347	120	363	Intracellular exo-alpha-(1->5)-L-arabinofuranosidase OS=Bifidobacterium longum OX=216816 GN=abfB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000692	0.998356	0.000229	0.000279	0.000234	0.000199

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000720_01138.