CAZyme Information: MGYG000000720_01235

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000000720_01235
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		39174.23	5.1458

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000720	3759035	MAG	Kazakhstan	Asia

• Gene Location: Start: 387; End: 1445 Strand: -

Full Sequence      

MQKETVLELKPAAGNPRNSEGAFLRLADGGILFAYSRYSGEGAEWEDDSPCDIAARNSRD
GGATWSGRDRILIPRGDAMNVMSVSLLRISPERIMMLYLRKSHDPQNRVECRPFVTFSED
EGESWETPRALTSVGGYFVVNNDRLLQLEQGRIIIPCAWHRPTENGHDSRAIGLFLLSDD
GGRTFREAADWVLPPQSSASGVQEPGVVELAPGKLLAFFRTDQGYQMTSVSDDAGEHWSS
VKPSNFISPLSPMTLKRDPFGGQLWAVWNDRSGRWNLPKPEESSWQRTPLTLGIGGKPDP
ESMELSLLENDPRCGYCYVALHFEPEYVLLACCCGGNGTIVLQPTRIIRLKR

Enzyme Prediction     

No EC number prediction in MGYG000000720_01235.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	32	244	1.1e-30	0.6198830409356725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	3.44e-36	22	320	18	311	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	2.58e-22	118	321	87	270	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	3.31e-07	116	264	493	624	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam13088	BNR_2	0.001	20	193	113	257	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46468.1	9.37e-106	6	351	10	355
QDT09444.1	1.31e-78	4	350	34	373
QEC54313.1	1.55e-77	2	338	34	357
QGA27046.1	3.99e-77	1	338	31	355
ACU05768.1	1.42e-76	3	335	39	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YW1_A	2.24e-08	118	248	426	546	ChainA, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW1_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW2_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW2_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW3_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW3_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW4_A Streptococcus pneumoniae sialidase NanC [Streptococcus pneumoniae],4YW4_B Streptococcus pneumoniae sialidase NanC [Streptococcus pneumoniae],4YW5_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW5_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],5F9T_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],5F9T_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4]
4YZ1_A	2.26e-08	118	248	445	565	CrystalStructure of Streptococcus pneumoniae NanC, apo structure. [Streptococcus pneumoniae TIGR4],4YZ1_B Crystal Structure of Streptococcus pneumoniae NanC, apo structure. [Streptococcus pneumoniae TIGR4],4YZ2_A Crystal Structure of Streptococcus pneumoniae NanC, in complex with 2-deoxy-2,3-didehydro-N-acetylneuraminic acid. [Streptococcus pneumoniae],4YZ2_B Crystal Structure of Streptococcus pneumoniae NanC, in complex with 2-deoxy-2,3-didehydro-N-acetylneuraminic acid. [Streptococcus pneumoniae],4YZ3_A Crystal Structure of Streptococcus pneumoniae NanC, in complex with Oseltamivir. [Streptococcus pneumoniae TIGR4],4YZ3_B Crystal Structure of Streptococcus pneumoniae NanC, in complex with Oseltamivir. [Streptococcus pneumoniae TIGR4],4YZ4_A Crystal Structure of Streptococcus pneumoniae NanC, in complex with N-Acetylneuraminic acid. [Streptococcus pneumoniae],4YZ4_B Crystal Structure of Streptococcus pneumoniae NanC, in complex with N-Acetylneuraminic acid. [Streptococcus pneumoniae],4YZ5_A Crystal Structure of Streptococcus pneumoniae NanC, in complex with 3-Sialyllactose [Streptococcus pneumoniae],4YZ5_B Crystal Structure of Streptococcus pneumoniae NanC, in complex with 3-Sialyllactose [Streptococcus pneumoniae]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000023	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000720_01235.