CAZyme Information: MGYG000000720_01273

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000000720_01273
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1135		125871.51	6.4302

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000720	3759035	MAG	Kazakhstan	Asia

• Gene Location: Start: 46972; End: 50379 Strand: +

Full Sequence      

MRTWFLAAAVCAAVSGVSASDGRWLIDDFEKTHFSWTTWADPASLPAERVFTFDAAAGKQ
AMRITFPQVASTAVIGRQGMRIPREANAVSLWIKRNMGEPQTLLMIKEERPNGNSFVARL
PASDGWSRVVVPLERFSPLKGKDPLRRNESISMNFVSYQTPKAGSFSVDQIEWIAMAGEE
MAAPALKGRRNLLPGDTGFETGVGSWLYFYADEPLRTTGGALEVKPGKSWISSGWVRGLR
EPGAEYVLSFDAKGAAGETLTVTLRTLDWEWVAERNFTVTPEWKRYSMKIPARQSVASPA
YIALARPVGDRESIWFDSVQFEAGTQPTPYQASEPVSCYATTGASGEVVREGDPVRLTVT
IHNADLPREKLPLRLALSAPGWAQNAVFDLQPGKTESRDFDCSEFARASGYYPVSLTLRD
RDGELLKQQYLPFVIAPEPEPIRSGEGFCGLHIDYTPQDAMRAIGVSFVRANTTHWNAVS
AGPGEFKPMQSRDFSRSRLNWFATLLDVASPPQWGRNPDGKTASPQAFAAFVEHVVRATG
KDVAAYEIQNEPDLTLPMRYGLPSQQCAGILAALFRAVHPVLQKSGKPLAFNVSGVGTEF
AEAVFREAGKSFDIYAPHTYAGYSRVIGPHSGYVVGPEAGKVREQLLQAVELIRRYGANQ
ELWIGEIGYGLDVDAAPDSVWAYRHGAFLARTLIWARTVPELRRILYFTGLGTFEQSRYE
YGIWRNDNGIRPLPAVAAYAAAARRLDAGTDFHIHAQGEFKIVGWRSHDRTIFAVWNAAA
GADPLPFELNPEEARVYTLFGTPAKNRFAVADQPFYIHAEPGCEETVLEQLLKTVSSRRP
LDVSGSLETNRLLRLRLRNNLDSEFFGTVSVPPGKPVAVRLSPQGEDVVRVELAEESCGG
EIRPEFRSADGCFFSPIQLPKMLMIRYRKLAGSWRDFKPAGTSPAFELRERSAIFPADPF
VAWRGEKDLSLRAWMFWDEEGLYLFAEVTDDRHSQPFRNGNIWQGDSLQFAFDAANDAPP
EGGYDNNDYEYGVALASEGGNPVLWCWQAAAGKTFPGPAAGIEADVNRVGMLTCYRIRIP
WEELAPLKPEPGRVIGFNVVVTERDERRAGHHLELAPGLAPYKNPGFFRKIILVR

Enzyme Prediction     

No EC number prediction in MGYG000000720_01273.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	962	1108	1.5e-21	0.7362637362637363

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	3.03e-46	944	1133	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	6.22e-19	968	1128	35	186	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	3.99e-18	952	1112	1	155	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd00005	CBM9_like_1	9.48e-09	973	1101	41	150	DOMON-like type 9 carbohydrate binding module of xylanases. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. The CBM9 domain frequently occurs in tandem repeats; members found in this subfamily typically co-occur with glycosyl hydrolase family 10 domains and are annotated as endo-1,4-beta-xylanases. CBM9 from Thermotoga maritima xylanase 10A is reported to have specificity for polysaccharide reducing ends.
pfam06452	CBM9_1	1.66e-06	968	1134	30	182	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44104.1	8.20e-258	25	1133	50	1168
AHF94659.1	4.35e-38	528	1133	83	712
ACZ43418.1	1.88e-26	346	1128	224	1028
AQX78961.1	5.00e-25	332	1134	203	1072
AHF89595.1	4.40e-24	319	1129	22	865

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000620	0.998428	0.000303	0.000198	0.000207	0.000195

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000720_01273.