CAZyme Information: MGYG000000720_01722

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000000720_01722
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1316	MGYG000000720_32|CGC1	145370.62	5.6661

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000720	3759035	MAG	Kazakhstan	Asia

• Gene Location: Start: 10889; End: 14839 Strand: -

Full Sequence      

MKRHHLSAAVLLALFLVGISTTLQASALAVDLSAGIRKYVPGGGAPTDYPFSNNGVEVNW
ETGKSKYIELVFNRSLPLPEFSKVSVTAKIEAPAGCPVRSIGLRLTDKTNETFQFSKSID
CSQGGVQEVTWEISAGRWQNSWGGNNDKNLDQPLKIYGMGVDYSQDVPEANFRILSVSAE
VADAPKSAQTTASALAVDLSAGIRKYVPGGGAPTDYPFSNNGVEVNWETGKSKYIELVFN
RSLPLPEFSKVSVTAKIEAPAGCPVRSIGLRLTDKTNETFQFSKSIDCSQGGVQEVTWEI
SAGRWQNSWGGNNDKNLDQPLKIYGMGVDYSQDVPEANFRILSVTAAVSGGEKTVATRPL
YGFDLSNAFNRFWGTGRTCLGPDGLLVSDIRGETSFNDRMSSLFFFHSRPVALTLDAALN
AGDVRCYWVFRDAANKQFKTAELPLKQGENHLTFRLEETLADAKLPLRVERFALVNSGSI
PGSVLLTGSTLGVEQPQVEAVDFEILTGNAVHVLKFGEESALRFRFTNTSNQAGRFSISL
EFKSFTGKTHVENYTASLQPGESRTFAAAWKPEEFGHWDVTATISESAAPQMQNRTTRSF
AYLKPSGPTPGHAPGFLFSVCTHSGRWSRVDQLREVEAASICGVKVVRDSIEWGGIQPQR
GVWNFEKMDFLVNAYEMVGIEHQAMFAFTAQWAATPERQKSKNWLDWNRSMPDLDAWREY
VRTVADRYRGRIRYWEVWNEPDLGGFNQMTLEEYVQLQKATYEELSTHVPEAIVMTGGFA
TMTDHPGKKSPTFHRDYLNLAKGAFEVHAYHEHGSFQQFAQVVDERFLPMRRETGTTVPW
YSNETAIHSLNGAERNQALTLFKKLLFAWSRGAIGYTWYDLRNDGFDPVDGEHNYGMLTN
DFQPKPVYSVYNMLAGLYRDMKFIRQFELGTNLWAFEFSNGSEILIPAWDESGFGSSLTL
VVKSDAAAASTVDLMGNEKPQELLDGMALLTLSPMPETLRLSGAKHAEIAGRLLEVSSAG
VAIPGRPFRFRMKLFNPLTSKRTFHLALQNLPGSFHAAVPEQTIAVPAGETAEAEFELTV
DKNFKAEYGSSSSLGVAYTLEGTPWQGAFSVPINSAVAIPAGMNFERDPDFVLADRSQVV
SLTAADPALNFRVWRDANDLSAKIFLGKSNDGLHLRVLVKDDKHCQPFSGSEVWKGDNIQ
FAFQLPGQSGHWEFGLSLLDSGKPEVHVFQTPTGFDPAAVAQACRLEAKRIGDVTTYDFS
LPEAAAGMTPEMFRSGFRFNLLVNDNDGDGRDGWIHIAPGIGDAKNPDKFPFVVFD

Enzyme Prediction     

No EC number prediction in MGYG000000720_01722.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	659	951	7.8e-30	0.728538283062645

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	3.26e-67	1129	1315	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	1.35e-08	1153	1300	29	175	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
pfam00331	Glyco_hydro_10	2.92e-08	615	755	9	149	Glycosyl hydrolase family 10.
cd00241	DOMON_like	9.45e-08	1143	1296	1	157	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
COG3693	XynA	1.30e-07	625	908	43	334	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47149.1	0.0	24	1316	21	1307
AVM46276.1	0.0	208	1316	30	1137
AVM44759.1	2.98e-205	359	1316	23	965
AHF94342.1	5.58e-168	490	1316	200	1033
AHF90198.1	1.16e-164	501	1315	193	1005

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	1.25e-18	620	1027	108	520	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000547	0.998483	0.000217	0.000322	0.000217	0.000185

TMHMM  Annotations     

start	end
7	29