CAZyme Information: MGYG000000720_02012

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000000720_02012
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
997		110680.37	6.6895

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000720	3759035	MAG	Kazakhstan	Asia

• Gene Location: Start: 11555; End: 14548 Strand: +

Full Sequence      

MRMFAGMIVLAAGILGNLGAAPIQSVDVFTPGKENALLLFHRRDNSQIRNFPVSGNPITV
DRADAPEAAYFDCQANPARNVPEFTRATFRSRVFLPPGHPVRSFNLRLIDADDEVFQFSA
IPPQGDGKWHEIAFAVDASRPEAGHWGGGAKADGKLTMPVRFRGVTGDFAGKTGTFGIGG
IRCDVLDSNAPVSPELRTGSGTPIHVLKAGEEEKLSLSLRNPRPRRMAGTLKWNLVGVRG
ELLGESTETVDLAPAEEKSFALPCPTAFGVYKLNVELCDKDPAVRPFRREMRFAYLIPAG
PTQGRTEGFVFGVCSHPQNTSAEIQRKEAMAAGWCGVKALREDIGWDRVQPAEGRWEFGS
FDRLVEIFGAYGIELMPIYSYCAGWAVAKGWKPLNPDFFHRARPDYDRWRTFVGTFAARY
RGKIRFAEIWNEPDLYMFANFPEDEYVRMLETAYDEIKRVVPELQVFCGGFACLPGQSGR
AGNPRVMPAVIRSGKYDIFAFHGHGLFGGYRDQIERLPSYGNRKPWYANETAVSSMVCGE
EIQAQTLFRKLIYSWAKGALGYNWYDLRNDGFDPANNEHNFGMLTHDFYPKPVYAAYNAL
ANLFQGGTFLRECRIGKDLHGYLFRDREGNMLLAAWSDTGDDRILPLAVSGVTGRAEKID
LYGNCKPLAATNAVVTFEVGSEPATLRVSGQSEAFKVAGALIHPVGALEVVPGESSALEF
AVFNPGSTPRKFQLGFALPDGISAEWNRKTFELAAGKTEVVRLPVQTDAGFRSAPGRQKE
LTLFLDGESFRYRIDSVARIPKQGYHQEPDFLLDAAGQVYAQVPNSPETAHLFWKGTQDL
SAKVWMGRDGEALLLKVEILDDRHVQPYSGEEVWKGDNIQFALLLPGQKERWEIGLTRLE
TGRGEVHVWQAPRRFDPVRTAAEITLETSRDENSHTTGYEARIPFKAIGLTDQAGREGFR
FNLLVNDNDGFGRESFIAIAPGIGESKDPSRYPVVKF

Enzyme Prediction     

No EC number prediction in MGYG000000720_02012.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	353	639	2.4e-24	0.728538283062645

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	4.89e-77	809	997	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	8.28e-14	834	982	30	175	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	1.01e-09	832	978	10	157	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam06452	CBM9_1	4.84e-06	833	996	20	180	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
pfam01229	Glyco_hydro_39	4.97e-05	333	639	55	385	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF94342.1	6.20e-263	14	997	36	1032
AHF90198.1	6.62e-237	42	997	41	1005
AVM47149.1	4.03e-178	200	997	498	1306
AVM46276.1	3.08e-176	202	997	336	1136
AVM44759.1	4.27e-161	293	997	254	964

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	3.27e-22	266	718	66	524	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]
4ZN2_A	6.43e-07	317	596	32	324	Glycosylhydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_B Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_C Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_D Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5BX9_A	6.43e-07	317	596	32	324	Structureof PslG from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5BXA_A Structure of PslG from Pseudomonas aeruginosa in complex with mannose [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000514	0.998732	0.000250	0.000165	0.000162	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000720_02012.