CAZyme Information: MGYG000000720_02241

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000000720_02241
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1174	MGYG000000720_53|CGC1	131905.38	7.1209

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000720	3759035	MAG	Kazakhstan	Asia

• Gene Location: Start: 953; End: 4477 Strand: -

Full Sequence      

MRGFLAFLMLLAVSATLHGATPDARGFVRDWLIGGAYPSYLVDGVDQGFRDDPLAAKGGE
ANLRPYAGMRDDALFKADKSRLIAGIGSTNEWGFKEDKTFPVIWKKFTQTGESPNIVFDG
WFDPIDDHMIVYAVCYIESPEARKIRLRIGSDDDFKAYLNGKLVGSANSSQGIVPDGFLH
DAELRRGLNVLVMKVVDRTHGTGFCLAISDRENRPMTDLVIRTDDPAREAMQRDKLAEIP
AAFDGGAYALFALTEKINLTGSNTLGVTIGSGNREACDAKLILSPAAGGRKIFRRNLEFN
GKSILWQEQVELPAGICRVRLELSRSGETTPFAILEEAFEIHDPAVVAARNAELKKQRAE
WLAKIKAGDEQRDSLIRTGAELKQRHAGLYAGQEEAWEALRRKNRGGEEANSIDEPLSPA
PVAARRRILLNGDLWKMGEGFSREAEKSGHTPPPDEAWKPGFLPRTHFNRYFRTWYYPVQ
NVKPKDPYGKVVSRKGWEDYTFDEIVTWQKFWARLDLDLGADAGTRSWDFVCEGVNGLLK
VYMNGEFCGRWEGNIGIVRIPLKGVRPGKNRLELYFSDPVTEFQLTGIPKFQERFGISGD
LRLESSAASVRIGDVAVKTRFRNNTIETVSEVENRSRTPAEVRLVSSCVLDGRVRYRLPE
MKGVVPPGEIVAFKSVGLWNDPVLWGIGGKYGDPVLYDLVSDLYVDGKLVDRTIEPFGFR
EFWIAGSDLFLNGRRIVLQGDVGMKGLDNRKVCDVMFPLLRADGINTIRNHDGAFQSPEF
FRSCDRLGMLAYANMYPVLHERGRDKPENFIPYDEFVASPRHAFNLRNYRRWYEMVRNHP
SVVVLATDNEIFTQAWDTPAKEKFNVRNDRLGALYGQYVKSLDPERIMTRDGDVGTWGFA
DKYHDDPPCDTANYHYPDFNIDRFVRNWQSVFGFRPVIYGETLYYSYGAWDNWIGAVPSQ
VEAKAKRVAEVARLYRELDVPGQIYMGLAHDGFIQFDDTGKGNVWGITASQHNAGEVPGR
PGYPWLRIPWPALSGTGLREEFTATDVKKSGMTVLNWFDGTHPSHVRNAVNEAYRSTLRP
MPPLAAAPDAECVVELGSAGAGRIVIAEAADGSTGQFGVTADSQGRAWFVLPRPGRYRFH
WDGRNREVELPGRAAYAAQPGFDRIMKIDWRKQQ

Enzyme Prediction     

No EC number prediction in MGYG000000720_02241.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	512	914	4.2e-35	0.44813829787234044

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.49e-14	533	851	106	407	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	2.14e-06	724	941	3	209	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	7.37e-06	680	889	240	446	beta-D-glucuronidase; Provisional
pfam00703	Glyco_hydro_2	8.23e-06	610	720	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44993.1	0.0	1	1174	54	1227
SEH75953.1	9.96e-22	512	942	262	668
QUH31336.1	8.21e-17	612	950	170	467
AIQ32428.1	4.31e-16	533	950	102	518
APU68349.1	7.10e-16	512	903	89	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FN9_A	4.05e-10	533	852	84	402	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
4CU6_A	2.36e-07	682	920	253	492	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]
4CUC_A	2.36e-07	682	920	253	492	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]
6ED1_A	1.22e-06	664	897	246	458	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
6NCW_A	1.75e-06	533	886	73	404	Crystalstructure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_B Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_C Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_D Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCX_A Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_B Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_C Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_D Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2VHN8	7.99e-07	531	909	144	502	Beta-galactosidase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=lacZ PE=3 SV=1
Q48846	1.95e-06	533	892	153	492	Beta-galactosidase large subunit OS=Latilactobacillus sakei OX=1599 GN=lacL PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000220	0.999151	0.000168	0.000160	0.000153	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000720_02241.