CAZyme Information: MGYG000000720_02748

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000000720_02748
• CAZy Family: GH129
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627		70336.27	6.6188

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000720	3759035	MAG	Kazakhstan	Asia

• Gene Location: Start: 10013; End: 11896 Strand: +

Full Sequence      

MYLTDTGVVTPLGVQPYETLLAGKLYNRSEKRLFPVADFRVSIVARSENRAELLLCSDSS
GILVPVRLELEPDELKLTIEAGRIVESASDMWRLMELSAFPDLMASRETDDGAYLLPLFS
GMRVPFRGQSPSRNRDRIFMERANWEKFGQCDAFGMFSGAADVLGIVGEGGFRAWVDSEF
NLGGRNRLCATFALRHQPRDVIPQEIKQLHLLFLEPTGRVDRMAFAYRRHLVEKRGIVPL
RERIGRNPVLDYAVHAMRVKIFLGQKRPFETDGSGTYVNCTTFSEAGEILQAMYDSGIRR
AVITLVGWNLGGHDGAYPTRFPVNSEAGGETGLRALIERALELGYQIVPHDNVTDVYLAS
PDYDPELVMLDEGGERQPAGVWAGGLSYKICPTVVLNRFGGEFRRIHRLGFRGSYYLDAQ
AAGLFCCTHPAHPADERTFALSLARIALLPRELFGSVSTEFVPSYMLPFADEASCIPGRR
QYERLKPQLPESLQALRGEVVPFYQIAVHGLLVHQAGWVHTYGETAGERRRGLLEELATG
ARPSMEVSMRPLCNGGNFRKSIDSILEFYRINFELCREIQTAFVRSWTSDGTRTVLEYDS
GHRFELDHGDSPSLRIIRNGELISVPR

Enzyme Prediction     

No EC number prediction in MGYG000000720_02748.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH129	213	516	7.5e-27	0.47249190938511326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18952	DUF5696	8.12e-32	59	612	18	595	Family of unknown function (DUF5696). This is a family of unknown function with some overlap with clan family members of CL0058.
cd14244	GH_101_like	2.69e-13	297	432	43	180	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam12905	Glyco_hydro_101	2.16e-04	292	374	51	133	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43182.1	7.25e-145	18	625	29	624
BCT45910.1	2.20e-15	207	469	209	477
QUH27706.1	1.43e-13	227	437	243	460
QTH41330.1	2.18e-11	206	513	226	532
ANH82215.1	2.30e-11	218	513	294	596

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000720_02748.