CAZyme Information: MGYG000000720_02800

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000000720_02800
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621	MGYG000000720_90|CGC1	69505.51	7.165

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000720	3759035	MAG	Kazakhstan	Asia

• Gene Location: Start: 8990; End: 10855 Strand: -

Full Sequence      

MKWYRWLLGAICSIGIGVTAGSPFGMCAHLNRMSPEEMRRELAAMADRGVQMVRVDLDWS
QVEPRPGEWDFSRWDALVEEAGKQGVAVLAILGGELHKPVRAPYRNLPDFLNYVEKCATR
YRGKIFAYEVINEADCDRPWGEKPNPEHYAELLKQCRQTIRSADPEAKVLFSGVSFVQNP
YGFLDRAFAAGAGSACDGVNFHPYQWKYVPEAQLLHKITELRELMKKHNLDKPVWITEIG
NSSGEQPVAFVREVVGAALKKLEIDPASQTIGIIRDDENFWYADGIHMQVGEILPEAKKL
RTLKFIELPALKPEACPVVILPGVEGFPVRQFGFVRDYVKRGGTVVIPGGIPFYFNVEKQ
SDGMFTNAWLTRQCPGELHFGWEASWTRNGVPAETQEVVPGEEFPELSPRKFSAGRFLTA
ANLKGNDRMIPIFYGVKGEYKAPVAALYRFDSDLKGNLVLIPGVMNECSSEIQQASLLVR
QYLLLLSAGVEGICYYRFRAGEWNRGREANFGILHRDFSPKPAAGAFQTLTRLYPDGSGQ
VTISEPATGVRTAVWQQPGGQRIYAVWSLSGDRRMKFSGEAVRIEDLCGEETKLSNKFFE
ARTAPVYFHAAPGATLEFSAR

Enzyme Prediction     

No EC number prediction in MGYG000000720_02800.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	101	238	5e-21	0.3665893271461717

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	6.47e-06	59	171	3	126	Glycosyl hydrolase family 10.
COG3693	XynA	1.94e-05	57	171	67	191	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44885.1	6.05e-115	1	607	1	607
QDU57372.1	4.73e-81	22	611	28	625
ATI35784.1	4.13e-31	13	249	39	289
ARE37417.1	3.59e-30	13	249	39	289
AZI63407.1	3.59e-30	13	249	39	289

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZN2_A	1.39e-12	25	247	22	259	Glycosylhydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_B Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_C Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_D Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5BX9_A	1.39e-12	25	247	22	259	Structureof PslG from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5BXA_A Structure of PslG from Pseudomonas aeruginosa in complex with mannose [Pseudomonas aeruginosa PAO1]
5M0K_A	1.58e-06	56	259	82	290	CRYSTALSTRUCTURE of endo-1,4-beta-xylanase from Cellulomonas flavigena [Cellulomonas flavigena],5M0K_B CRYSTAL STRUCTURE of endo-1,4-beta-xylanase from Cellulomonas flavigena [Cellulomonas flavigena]
1EXP_A	3.05e-06	20	202	11	205	Beta-1,4-GlycanaseCex-Cd [Cellulomonas fimi],1FH7_A Crystal Structure Of The Xylanase Cex With Xylobiose- Derived Inhibitor Deoxynojirimycin [Cellulomonas fimi],1FH8_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Isofagomine Inhibitor [Cellulomonas fimi],1FH9_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Lactam Oxime Inhibitor [Cellulomonas fimi],1FHD_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Imidazole Inhibitor [Cellulomonas fimi],1J01_A Crystal Structure Of The Xylanase Cex With Xylobiose-Derived Inhibitor Isofagomine lactam [Cellulomonas fimi],2EXO_A Crystal Structure Of The Catalytic Domain Of The Beta-1,4- Glycanase Cex From Cellulomonas Fimi [Cellulomonas fimi],2XYL_A Cellulomonas Fimi XylanaseCELLULASE COMPLEXED WITH 2-Deoxy- 2-Fluoro-Xylobiose [Cellulomonas fimi]
3CUF_A	3.10e-06	20	202	11	205	Cellulomonasfimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellobiose-like isofagomine [Cellulomonas fimi],3CUG_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellotetraose-like isofagomine [Cellulomonas fimi],3CUH_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellotriose-like isofagomine [Cellulomonas fimi],3CUI_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with sulfur substituted beta-1,4 xylotetraose [Cellulomonas fimi],3CUJ_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with sulfur substituted beta-1,4 xylopentaose. [Cellulomonas fimi]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.099198	0.075251	0.824898	0.000209	0.000183	0.000242

TMHMM  Annotations     

start	end
7	29