CAZyme Information: MGYG000000720_02937

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000000720_02937
• CAZy Family: GH110
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616		69137.68	6.5411

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000720	3759035	MAG	Kazakhstan	Asia

• Gene Location: Start: 1264; End: 3114 Strand: -

Full Sequence      

MIHRVDKTRLFPLDFSDGDGDGELRRRCAGRELLEQIRRAARAGEKVVRIASGNYCFPGK
TGILLENLCDIVIEAEEEATFWFSSEVAAGVHFRNCRNVRFAGVAFDMEALPFLQGTLTS
VSEEHLTIRLDEYFVRRFHEERTQNHFRLMFLDPAGRYETDNLDFIIPREKLSFDPEGNL
RVPVPEPVSRHWRYQLRMPTPGDRVVLGMRRDGGGMLLVDSCENMEFEAITIYASPGFAF
YETGHGGGGNTYRRCRLIRRPGTDRLLASAADCFHSMNQHRGPLIEACEFSWAMDDLVNI
HGYFHVVVEPLAKDELLIVTPFGTDLPDGTELFFFSAPRGVEKCRAVVVSSRETVGSEEE
GLRCIKELYKRKFGIELQSFPGGSFCRIRLDRPVDIEPGDFACSYGSCGSGAILRNNHLH
DCHVRGILLKAADCRIEGNRIERIALNGIILKPEFFWLEGPMPRNIVIRGNRLNDCAFGH
TAIAAILVMCGCCAPPSDRITPTINTEKITIADNEISNCNAGPAIAVFNSRNPRVSNNRI
NRPFSNPAAFGNLDISRRLDFFGRPLSEEESSRLRETHSAILFLSSEAIECPDNRLNDPG
HRCRTLIYTGPGCPGN

Enzyme Prediction     

No EC number prediction in MGYG000000720_02937.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH110	59	543	1.7e-31	0.8321167883211679

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	1.95e-09	405	538	50	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	2.73e-09	409	542	8	112	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	3.91e-06	426	542	2	89	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	4.19e-06	426	541	21	104	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
TIGR03804	para_beta_helix	0.002	505	541	6	40	parallel beta-helix repeat (two copies). This model represents a tandem pair of an approximately 22-amino acid (each) repeat homologous to the beta-strand repeats that stack in a right-handed parallel beta-helix in the periplasmic C-5 mannuronan epimerase, AlgA, of Pseudomonas aeruginosa. A homology domain consisting of a longer tandem array of these repeats is described in the SMART database as CASH (SM00722), and is found in many carbohydrate-binding proteins and sugar hydrolases. A single repeat is represented by SM00710. This TIGRFAMs model represents a flavor of the parallel beta-helix-forming repeat based on prokaryotic sequences only in its seed alignment, although it also finds many eukaryotic sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45745.1	0.0	10	615	1	604
AHF90844.1	3.64e-53	30	594	27	603
AHF89502.1	2.51e-47	12	600	68	645
QDU56661.1	9.94e-37	32	538	47	539
AHF94754.1	1.13e-34	37	542	45	550

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000720_02937.