CAZyme Information: MGYG000000720_03016

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000000720_03016
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1087		122284.53	6.4334

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000720	3759035	MAG	Kazakhstan	Asia

• Gene Location: Start: 2325; End: 5588 Strand: +

Full Sequence      

MKRVLYFLLFSIAAFGCSAGEVDFSRFAGSNFWAAGGKAGVAPEGDGLLVSWDPAVRRFM
EFTFPVAQPLGTFQIATVTVKLKRSAQSTFSALSLRLMDRDGEIFQFRAAAGEGVEELNY
RIDGNDTARAASWKSSAEATMNRKLDFPVKLLGFAVDYPAGSAPGEVRISSMTYEKFPEE
REPILVKEGVAVPGKVFSVGREGDVRVFEYAEGVNFPVLNGGQFRLRLKCSGGNPQAILL
LEHGEQEKPLKAATVKPDGKDGVTLIYPVPYELDTMSVSLRKICVESGEDVQLVELAYEI
PHVKLDFLFGAGSPVNVWQQGTPGKYRIANSGREALSGKAELIWSDLAGRKLDHRIETLS
LAPGEACEFPLPEPERFGLYRLSGTLPGAGGRPVYFSRRVGYMPPNETTEHDKMQYGVVL
LTPALPRLELCALAARLCGADFDRSSIIWMYIERHEGKWDWSYPDAHSRILKKNHLRWAP
ILWCPPRWATSKSWKPSYEPILPTFGFPLPDYRLWEEYVRNSVERYGRDNIRVMEVWNEA
ELPGFANFTPEEYAELLKRAYDVIKSVNPEIKVAICGFTCLPGQHPKMTFPDFMPRALRA
ARGKYDLHPIHLHGFFHEYAGGIRDFLRLRREWNITVPWAANETAITSSFCSRQVQAEVL
FEKMVFSQANGAVAHVWHNMYDLGRDPYNKEHNFGLLDHALEPKEAYLAFNNVTRLFRGA
ELLRDLSFDECSVYLFRKGKQLLLPAWTLYPPVSERLLVLENVQGDVYQVDVFGNRAPVE
VIDGKLLLPVTSSPATLVLEQRELPVVRGELFVPAGNTGEFRLAGKGVVRSVIGQPEGED
ARELAVKDGVFRMEFDPGRLQKPLTLTLTFDTEFGKAAVRQFITPRFTLRARTGFDRPAD
FERCDGSSFQQTSPNDPMFAECIWKGREDCSVKLWLGWKSPDRIVIRAVVRDDIHFQDQN
GTLIYQGDGLQFFFSRTATGGMWKFGVARDNRGNVRKFCWLNPAQCDGPALLNQIAAAVS
RDEQKKETVYDLEVPADTLGIVRGVPFRFNLLVNDNDGRCREGYHALTEILDDGRNDNGY
PVVLFED

Enzyme Prediction     

No EC number prediction in MGYG000000720_03016.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	6.58e-38	924	1085	22	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	2.87e-07	924	1058	30	162	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	3.06e-06	923	1067	11	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam01229	Glyco_hydro_39	3.32e-04	508	573	120	193	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43799.1	0.0	1	1087	1	1088
AHF94342.1	2.36e-117	44	1086	79	1033
AHF90198.1	7.02e-104	43	1085	51	1005
AVM47149.1	5.66e-95	45	1086	211	1307
AVM46276.1	1.54e-90	38	1086	35	1137

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001131	0.320142	0.677907	0.000316	0.000258	0.000230

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000720_03016.